SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014354 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014354
Domain Number 1 Region: 334-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-29
Family SPRY domain 0.0029
Further Details:      
 
Domain Number 2 Region: 156-268
Classification Level Classification E-value
Superfamily Fibronectin type III 2.54e-18
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014354   Gene: ENSSSCG00000013505   Transcript: ENSSSCT00000014752
Sequence length 496
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:74964684:74978593:-1 gene:ENSSSCG00000013505 transcript:ENSSSCT00000014752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDQREALRKIITTLAVKNEEIQSFIYSLKQMLLNVEANSAKVQEDLEAEFQSLFSLLEE
LKEGMLMKIKQDRASRTYELQNQLAACTRALESSEELLETANQTLQATDSGDFPQAAKQI
KDGVTMAPAFRLSLKAKVSDNMSHLMVDFAQERRMLQALTFLPVPSAPVIDLAESLVADN
CVTLVWRMPDEDNKIDHYVLEYRRTNFEGPPRLKEDQPWMVIEGIRQTEYTLTGLKFDMK
YMNFRVKACNKAVSGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDI
KAREKDGKGRTASPVNSPARGIPSPKRMPSGRGGRDRFTAESYTVLGDTLINGGEQYWEV
RYEPDSKAFGVGVAYRSLGRFEQLGKTAASWCLHVNNWLQVSFTAKHANKAKVLDAPVPD
CLGVHCDFHQGLLTFYNARTKQLLHTFKAKFTQPLLPAFTVWCGSFHVTTGLQVPSSVRC
LQKRGSATSSSNTSLT
Download sequence
Identical sequences A0A287BIN4
XP_003480876.1.46622 ENSSSCP00000014354 ENSSSCP00000014354 9823.ENSSSCP00000014354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]