SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014405 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014405
Domain Number 1 Region: 520-800
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000275
Family Rhodopsin-like 0.024
Further Details:      
 
Domain Number 2 Region: 3-126
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000361
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 185-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000164
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 142-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000215
Family EGF-type module 0.038
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000014405
Domain Number - Region: 353-414
Classification Level Classification E-value
Superfamily 14-3-3 protein 0.0227
Family 14-3-3 protein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014405   Gene: ENSSSCG00000013556   Transcript: ENSSSCT00000014806
Sequence length 807
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:72699548:72739564:1 gene:ENSSSCG00000013556 transcript:ENSSSCT00000014806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIDECSQSPPACGPHSVCRNLPGSYKCSCLPGFSSPTGDDWIPAKGGRFACVDINECLQS
GVCPEHSQCTNSLGSYSCSCHVGFTSTNSICEDVDECANPRACPEHASCRNSVGSYSCVC
KSGFESSTGKMGIQGPGETCRDVDECANPRACPEHASCRNSVGSYSCVCKSGFESSTGKM
GIQGPGETCRDVDECSSNSTLCGPSSVCTNLPGKYSCSCLPGFFSPGVWSPEKPEAFKCT
GVPFKCKEDVMPNNEWVQLCQDGAAVKPKYVSFCAVMNATFSVLDDACKKTTAVSLKNTA
ERFASVIEKTFTRSSFTKEEISTLATVLLKSVESTTLASFLKPSANVSQTIQTEYLDIES
KVINKGCTEEDETFNLKAKGDKMKIWCSTIKESESTGISGVAFVSFEHMESVLDERFFQD
PQTPWANSKRKLKMNSRIVSGIITGEKKEGFSKPVIYTLENIQPKQNFESPICVSWNTDG
KGGRWTPSGCVTLEASETHTVCSCNQMVNLAVIMASGELTMEFALFVISHVGTIFSLVCL
AVAIITFLLCRTIRNHNTYIHLHLCVCLFLANLLFLTGADKTHHQIGCAIIAGFLHYLFL
ACFFWMLVEAVMLFLMVRNLKVVNYFSSHNIKMLHLCAFGYGLPGLVVFVAANIHPQGYG
MYNRCWLNTEKGFIWSFLGPVCTIIVVNSILLTWTLGILRQKLSSLNDEVSTLKDTRLLT
FKAFAQIFILGCSWVLGIFQIGPIAGIMAYLFTVINSLQGAFIFLIHCLLNRQVREAYSR
CITGKTKPGSQTSGISLSSVPSASKTG
Download sequence
Identical sequences ENSSSCP00000014405 ENSSSCP00000014405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]