SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014416 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014416
Domain Number 1 Region: 300-465
Classification Level Classification E-value
Superfamily L domain-like 8.51e-53
Family L domain 0.0000000867
Further Details:      
 
Domain Number 2 Region: 1-162
Classification Level Classification E-value
Superfamily L domain-like 3.12e-43
Family L domain 0.000000112
Further Details:      
 
Domain Number 3 Region: 462-585
Classification Level Classification E-value
Superfamily Fibronectin type III 3.87e-34
Family Fibronectin type III 0.000000161
Further Details:      
 
Domain Number 4 Region: 146-302
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000204
Family Growth factor receptor domain 0.0000000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014416   Gene: ENSSSCG00000013566   Transcript: ENSSSCT00000014817
Sequence length 591
Comment pep:known chromosome:Sscrofa10.2:2:72275693:72357630:-1 gene:ENSSSCG00000013566 transcript:ENSSSCT00000014817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCPGMDIRNNLTRLHELANCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRV
YGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGAVRIEKNNELC
YLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHS
HCQKVCPTICKSHGCTAEGLCCHSECLGNCSEPDDPTKCVACRNFYLDGRCVETCPPPYY
HFQDWRCVNFSFCQDLHNKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLG
PCPKVCHLLEGEKTIDSVTSAQELRGCTIINGSLIINIRGGNNLAAELEANLGLIEEISG
YLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKL
FFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSYDKIL
LKWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPTRSNDPKSQ
NHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATSKHV
Download sequence
Identical sequences ENSSSCP00000014416 ENSSSCP00000014416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]