SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014530 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014530
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-16
Family Laminin G-like module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014530   Gene: ENSSSCG00000013667   Transcript: ENSSSCT00000014931
Sequence length 1614
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:69156853:69193845:-1 gene:ENSSSCG00000013667 transcript:ENSSSCT00000014931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPIPQQINLTDGRWHRVAVSVNGRTATLVADCEPQSPVLVQGPRFISTAGLTVLGTQDLE
EETFEGDIQELLISTDPQAAFQACEQYLPGCNDLDPKPTGVPQGEPESPPPRRKGKGKGK
KKGRGRKGKGRKKKNKETLALSPPPVSLENQTSTDIPKTETRAPTLPPTPTSLVITTTVA
IGSNVTILEEGLDPDNGIELGTLATELDNEDEEEGESTMGPSFRAAEQSWSTQFQIFSGA
GEKGEKGEPAVIEEGQHFEGPPGATGPRGIVGPSGPPGPPGFPGDPGPPGPAGLPGIPGI
DGIRGLPGTVIMMPFQLAGGSLKGPPVSFQQAQAQAILQQAQLSMKGPPGPVGLTGRPGP
MGLPGYPGLKGEMGEMGPQGPRGLQGPLGPPGREGKMGRPGADGARGLPGDTGPKGDRGF
DGLPGLPGEKGQRGDFGHVGQPGPPGEDGEKGAEGPPGPTGQAGEPGPRGLIGPRGSPGP
LGRPGVVGIDGAPGAKGNVGPPGEPGPPGQQGNPGSQGIPGPQGHIGIPGEKGPPGNPGI
PGLPGSDGPPGHPGHEGPTGEKGAQGPSGSAGPPGYPGSRGVKGTSGNRGLQGEKGEKGE
DGFPGFKGDVGPKGDWGQPGPPGPRGEDGPEGLKGQEGLAGEEGPPGSAGEKGKLGLPGL
PGYPGRPGPKGSIGFPGPLGPLGEKGKRGKAGQPGLEGERGPPGPRGERGQPGATGQPGP
KGDVGQDGAPGFPGEKGLPGLQGPPGFSGPKGPPGPQGKDGRPGHPGQRGELGFQGQTGP
PGPAGVVGPQGKTGEAGPLGERGPPGPPGPPGEQGLPGLEGREGAKGDLGPLGPLGKEGP
PGLRGPPGPKGAPGDPGPTGLKGDKGPPGPTGANGPPGERGPVGPAGGIGLPGQSGGQGP
VGPMGEKGSPGERGSPGPTGKDGIPGPLGLPGPPGAAGPSGEEGDKGEVGAPGHKGSKGD
KGDAGPPGPIGIQGPVGHPGSPGADGAQGRRGPPGLFGQKGEDGVRGFVGVIGPPGLQGL
PGPPGEKGDVGDVGSMGPHGAPGPRGPHGPSGSEGPPGLPGGVGQPGAVGEKGEPGEAGD
PGPPGSPGIPGPKGEIGEKGDSGPSGAAGPPGKKGPPGEDGAKGNVGPTGLPGDLGPPGD
PGVSGQDGPPGEKGDPGDVGGPGPPGASGEPGPTGPPGKRGASGRMGREGREGEKGAKGE
PGPDGPPGRTGPVGARGPPGRVGPEGLPGIPGPVGEPGLLGPPGQLGPPGPLGPSGLPGL
KGDAGPKGEKGHIGLIGLIGPPGEAGEKGDQGLPGVQGPPGLQGEPGSPGPIGSLGHPGS
PGVAGPPGQKGSKGSPGSQGPRGDTGPPGPPGPPGPSAELHGLRRRRRSVPVLGPGVPEG
GLEEVLASLTSLSLELEQLRRPPGTAERPGLVCSELHRNHPHLPDGEYWIDPNQGCARDA
IRVFCNFTAGGETCLHPDKKFETVKLASWSREKPGNWYSTFRRGKKFSYVDADGSPVSVV
QLTFLKLLSAIARQSFTYSCQNSAAWLDEAAGNYGRSLRFLGTNGEELSFNQTAAATITV
PYDGCRLRKGQTKTLLEFSSSRVGFLPLWDVAAIDFGQTNQKFGFELGPVCFSS
Download sequence
Identical sequences ENSSSCP00000014530 ENSSSCP00000014530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]