SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014532 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014532
Domain Number 1 Region: 47-163
Classification Level Classification E-value
Superfamily FKBP-like 1.05e-34
Family FKBP immunophilin/proline isomerase 0.000000467
Further Details:      
 
Domain Number 2 Region: 2-39
Classification Level Classification E-value
Superfamily WW domain 0.000000000000949
Family WW domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014532   Gene: ENSSSCG00000013669   Transcript: ENSSSCT00000014933
Sequence length 163
Comment pep:known chromosome:Sscrofa10.2:2:69045733:69059250:1 gene:ENSSSCG00000013669 transcript:ENSSSCT00000014933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSGGSKNGQGEPTRVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCNSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Download sequence
Identical sequences I3LLH5
ENSSSCP00000014532 ENSSSCP00000024945 9823.ENSSSCP00000014532 NP_001231300.1.46622 ENSSSCP00000014532 ENSSSCP00000024945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]