SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014657 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014657
Domain Number 1 Region: 85-198
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 207-248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000147
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000014657
Domain Number - Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00251
Family Growth factor receptor domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014657   Gene: ENSSSCG00000013785   Transcript: ENSSSCT00000015062
Sequence length 676
Comment pep:novel chromosome:Sscrofa10.2:2:64781428:64851106:1 gene:ENSSSCG00000013785 transcript:ENSSSCT00000015062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAPPLPAVFFPSLSLLTMVSVATSVPTACARWCPPNSSCVNSTACRCLPGFSASSGEVFT
SPSDSCDDINECAPPAAVSCGKNAECLNTDRGYHCICTPGYELASGAPTFRNESENTCQD
VDECQQKLRICKSHSICINTQGSYICQCLPGFKLNPRDPKLCTDVNECTPGSNPCHNSTH
CFNLVGRYECRCRPGWKPIPGDPSSPKDIVCEDKDECSSGEHHCHNSTICTNTVGSYVCH
CRRGWVPKPGFQNKKNTTICEEVSFPTWMPPPGIKSQRLSCFFHRLQDLRGNLRSVSVQS
TIQDLIQEVGDLLEGPQDLENLSQSEQQFVATNLLLGLENALGWLGKALPIGAVTFSSSA
GTVLSLEVQEQGYENITLIQNQTKMLLTWDTVHESGDSGPTVVGLLSTPGVGRFLAKAPL
VLDTVEQAALHETHKGVLQELYHDLLSDVISAFISNKDPQNLRHPVTFIFQHSVIPGPRE
KVFCVFWEHGQNGSGHWATSGCRMVGTKDNSTICQCTHLSSFAILMAHYEVQDKDSALTV
ISYVGLSLSLLCLLLAVLTFLFCKAIHNTSTSLHLQLSICLFLAHLLFLTAIDRTEVKVL
CSIIAGALHYLYLASFTWMLLEGLHLFLTARNLMAVNYSSVNKFMKKLMFPVGYGVPAVI
VTISAASRPHLYGTPT
Download sequence
Identical sequences ENSSSCP00000014657 ENSSSCP00000014657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]