SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014732 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014732
Domain Number 1 Region: 19-204,297-334
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-63
Family Calnexin/calreticulin 0.00012
Further Details:      
 
Domain Number 2 Region: 206-290
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 5.49e-22
Family P-domain of calnexin/calreticulin 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014732   Gene: ENSSSCG00000013858   Transcript: ENSSSCT00000015137
Sequence length 384
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:60738215:60767262:1 gene:ENSSSCG00000013858 transcript:ENSSSCT00000015137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAACVALWVVCVLRVTLATIYFQEEFLDGERWRNRWVQSSNDSQFGHFRLSSGKFYGHK
EKDKGLQTTQNSRFYAISARFKPFSNKGKNLIIQYTVKHEQKMDCGGGYIKIFPADVDQK
NLNGKSQYYIMFGPDICGFDIKKVHVILYFKNQYHSNKKSIRCKVDGFTHLYTLILRPDL
TYEVKIDGQSIESGSIEYDWQLTSLKKMEMASAESKDWDQATEKPQDWEKHFLDAGASKP
SDWNSELDGDWQAPMLQKPPYQDGLKPEGIDKDIWLHQKMKHTNYLTEYDLSEFENIGAI
GLELWQVRSGTIFDNFLITDDEEYAENFGKATWGETKDPEREMDAIQAKEEVKKAREEDE
EDFQMGRFNGQENNFRRFYRRNEL
Download sequence
Identical sequences F1S9W5
9823.ENSSSCP00000014732 XP_003123521.1.46622 XP_020939244.1.46622 ENSSSCP00000014732 ENSSSCP00000014732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]