SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014796 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014796
Domain Number 1 Region: 528-743
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-105
Family Thrombospondin C-terminal domain 0.0000000869
Further Details:      
 
Domain Number 2 Region: 405-526
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.24e-34
Family TSP type-3 repeat 0.00000382
Further Details:      
 
Domain Number 3 Region: 29-73
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 1.96e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00012
Further Details:      
 
Domain Number 4 Region: 337-407
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000000955
Family TSP type-3 repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 266-348
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000262
Family TSP type-3 repeat 0.00017
Further Details:      
 
Domain Number 6 Region: 119-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000024
Family EGF-type module 0.027
Further Details:      
 
Domain Number 7 Region: 172-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000014796
Domain Number - Region: 225-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00209
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 88-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0256
Family EGF-type module 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014796   Gene: ENSSSCG00000013916   Transcript: ENSSSCT00000015202
Sequence length 756
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:58815802:58823375:1 gene:ENSSSCG00000013916 transcript:ENSSSCT00000015202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLTVARVLLITLAALGASGQGQITLGADLGPQMLRELQETNAALQDVRELLRQQVKEIT
FLKNTVMECDACGMQPARTPRLSVRPLSQCAPGFCFPGVACTETASGARCGPCPAGFTGN
GSHCADVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHEGVGLAFAKANKQVCTDI
NECETGQHNCVPNSVCVNAVGSFQCGPCQPGFVGDQASGCRRRSQRFCPDGTPSPCHEKA
DCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCSERQCRKDNCVTVPNSGQE
DVDRDGIGDACDPDADGDGVLNEQDNCPLVRNPDQRNADGDKWGDACDNCRSQKNDDQKD
TDQDGRGDACDDDIDGDRIRNTVDNCPRVPNSDQKDSDGDGIGDACDNCPQKSNADQRDV
DHDFVGDACDSDQDKDGDGHQDSRDNCPTVPNSAQQDSDHDGQGDACDDDDDNDGVPDSR
DNCRLVPNPGQEDVDRDGVGDACQGDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDP
EGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIF
GYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTA
SQVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGR
LGVFCFSQENIIWANLRYRCNDTIPEDYEAQRLLQA
Download sequence
Identical sequences ENSSSCP00000014796 9823.ENSSSCP00000014796 ENSSSCP00000014796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]