SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014840 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014840
Domain Number 1 Region: 283-464
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-65
Family SPRY domain 0.0000107
Further Details:      
 
Domain Number 2 Region: 10-84
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-19
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 90-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000687
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014840   Gene: ENSSSCG00000013958   Transcript: ENSSSCT00000015246
Sequence length 480
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:56454174:56475699:-1 gene:ENSSSCG00000013958 transcript:ENSSSCT00000015246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGAPGERLCEEARCPVCLDFLQNPVSVDCGHSFCLKCISEFCEKSDSAQSGLYACPQC
RGPFRQENFRPNRQLASLVESVRQLGLGAGPSSSRLCVKHHEELTRFCKEDQEALCWVCD
TTPEHRSHHTEPLQEAARCYQVKLQMAQELVRNEMEEASTQEANIGKKTVIWKEKVEIQR
QRFRLEFEKYRGFLALEEQLQLRRLEEEERATLQRLRESKNQLVQHSRALKELAEELEER
CQRPPLGLLEGVGGALNRSKSVTRLEPEIIPMELKTMCRIPGMREMLRKFQVDIKLDPAT
AHPSLLLTADLRSVQDGELWKDVPNNPERFDTWPCVLGLQNFSSGRHYWEVVVGERAEWG
LGVCQDTVSRKGETTPSPENGVWALWLLKGGEYMVLASPSVPLLHLERPHCIGIFLDYEA
GEISFYNVTNGSYIYTFNQLFSGFLRPYFFICDTTPLILPPLTKVELENWAYRGHLDDPS
Download sequence
Identical sequences A0A287BHH6
XP_020939054.1.46622 ENSSSCP00000014840 ENSSSCP00000014840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]