SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014885 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014885
Domain Number 1 Region: 288-461
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-51
Family SPRY domain 0.000021
Further Details:      
 
Domain Number 2 Region: 9-89
Classification Level Classification E-value
Superfamily RING/U-box 8.58e-21
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 93-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.98e-18
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014885   Gene: ENSSSCG00000014000   Transcript: ENSSSCT00000015292
Sequence length 476
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896509.1:24987:30254:-1 gene:ENSSSCG00000014000 transcript:ENSSSCT00000015292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAVELARKLQEEATCSICLDYFTDPVMTACGHNFCRECIQLTWEKAKGQKRRRKQKGSF
PCPECRELSPQRNLRPNRLLTKVAEMARQHPSLHSRDLCQVHKELLKLFCEDDQSPICVI
CRESQEHRPHRVVPIEEAVQEYKLKLEKDMEYLREEMMKTGNLQAKEEQTLAEWQEKVKE
RREHIMVEFEKMDLFLMEEKQRLLQALKKEEEEMVAKLQKSIALLEQQSHSLEMLLLQLE
DKNERTPLQKLQDMKDLLSRRKNNLSVQYPEATTTKLKTVCRVPGQIEVLKNFQEDVMPD
PTTAYPYLLLYESRQRRYLSTPVDGTACGKDRFLAYPCVVGQETFSSGRHYWEVGMNLTG
DALWALGVCRDNVSRRGRVLKSPENGFWVVQLCKGKRYAPTMSALIPITLTEPPSHMGIF
LDFEAGEVSFYNVNNGSHLHTYSQPAFPGPLQPFFCLGAPKSGQMVISTVTLWVKG
Download sequence
Identical sequences ENSSSCP00000014885 ENSSSCP00000014885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]