SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014907 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014907
Domain Number 1 Region: 61-271
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-86
Family Calnexin/calreticulin 0.00000000276
Further Details:      
 
Domain Number 2 Region: 270-410
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.31e-58
Family P-domain of calnexin/calreticulin 0.0000000312
Further Details:      
 
Domain Number 3 Region: 412-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000253
Family Calnexin/calreticulin 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014907   Gene: ENSSSCG00000014020   Transcript: ENSSSCT00000015315
Sequence length 593
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:80445609:80482509:-1 gene:ENSSSCG00000014020 transcript:ENSSSCT00000015315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGKWLLCMLLVLGTAVVQAHDGHDDDVIDIEDDLDDVIEEVEDSKPKPDTSAPPSPKVT
YKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKG
LVLLSRAKHHAISTKLNKPFIFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQF
HDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYT
LILNPDNSFEILVDQAVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPDAV
KPDDWDEDAPAKIPDEEATKPIGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPK
CESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPF
SAIGLELWSMTSDIFFDNFIICGDRRVVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEE
RPWLWVVYILTVALPVFLVILFCCSGKKQASPVEYKKTDAPQPDVKEEEEEKEEEKEKGD
EEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
Download sequence
Identical sequences A0A287AXF5
XP_020934812.1.46622 ENSSSCP00000014907 9823.ENSSSCP00000014907 ENSSSCP00000014907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]