SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014929 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014929
Domain Number 1 Region: 56-279
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.72e-71
Family Lectin leg-like 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014929   Gene: ENSSSCG00000014040   Transcript: ENSSSCT00000015337
Sequence length 359
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:82260727:82273530:-1 gene:ENSSSCG00000014040 transcript:ENSSSCT00000015337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAGWFWLWGWGRRCPGRPGLPGPGPGPITRLLFLLLLGPVTADITDGNSEHLKRE
HSLIKPYQGVGSSSTLFWDFQGSTILTSQYLRLTPDERSKEGSIWNHLPCFLKDWEMHVH
FKVHGAGKKNLHGDGIALWYTRDRMVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYI
SVMVNNGSLSYDHSKDGRWTELAGCTADLRNRNHDTFLAVRYSRGRLTVMTDLEDKNEWK
NCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEENIDWTKIEPSVN
FLKSPKDNVDDPTGNFRSGPLTGWRVFLLLLCALLGIIVCAVVGAVVFQKRQERNKRFY
Download sequence
Identical sequences F1S3D5
ENSSSCP00000014929 XP_005661508.1.46622 ENSSSCP00000014929 9823.ENSSSCP00000014929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]