SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014973 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014973
Domain Number 1 Region: 444-583,700-860
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 2.09e-115
Family Substrate-binding domain of HMG-CoA reductase 0.000000000079
Further Details:      
 
Domain Number 2 Region: 586-702
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 8.37e-45
Family NAD-binding domain of HMG-CoA reductase 0.000000545
Further Details:      
 
Domain Number 3 Region: 45-219
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0000746
Family Multidrug efflux transporter AcrB transmembrane domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014973   Gene: ENSSSCG00000014080   Transcript: ENSSSCT00000015381
Sequence length 887
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:85967321:85990095:1 gene:ENSSSCG00000014080 transcript:ENSSSCT00000015381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNDKICGWNYECPKFEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLIDLSRASALAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG
VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR
VLEEEENKPNPVTQRVKIIMSLGLVLVHAHSRWIADPSPQNSTADNSKVSLGLDENVSKR
IEPSVSLWQFYLSKMISMDIEQVITLTLALLLAVKYIFFEQAETESTLSLKNPITSPVVT
QKKVTDDCCRREPTLVRNDQKFHTVEEEARINRERKVEVIKPLVAETDTSSRPTFVVGNS
TLDSSLELEMQEPEIQIPSEPRPNEECLQILGNAEKGAKFLSDAEIIQLVNAKHIPAYKL
ETLMETHERGVSIRRQLLSKKLPEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGVA
GPLCLDGKEFQVPMATTEGCLVASTNRGCRAIGLGGGASSRILADGMTRGPVVRFPRACD
SAEVKAWLETPEGFAVIKEAFDSTSRFARLQKLQMSVAGRNLYIRFQSRSGDAMGMNMIS
KGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAVNWIEGRGKSVVCEAVIPAKVVREVL
KTTTEAMVEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLM
EASGPTNEDLYISCTMPSIEIGTVGGGTSLLPQQACLQMLGVQGACKDNPGENARQLARI
VCGTVMAGELSLMAALAAGHLVRSHMIHNRSKINLQDLQGTCTKKAA
Download sequence
Identical sequences F1S2I4
ENSSSCP00000014973 9823.ENSSSCP00000014973 ENSSSCP00000014973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]