SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015012 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015012
Domain Number 1 Region: 711-926
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-106
Family Thrombospondin C-terminal domain 0.000000101
Further Details:      
 
Domain Number 2 Region: 217-262
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 3.4e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00094
Further Details:      
 
Domain Number 3 Region: 532-611
Classification Level Classification E-value
Superfamily TSP type-3 repeat 7.72e-17
Family TSP type-3 repeat 0.00043
Further Details:      
 
Domain Number 4 Region: 41-154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000407
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 5 Region: 482-544
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000106
Family TSP type-3 repeat 0.00022
Further Details:      
 
Domain Number 6 Region: 372-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000336
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 675-709
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000012
Family TSP type-3 repeat 0.002
Further Details:      
 
Domain Number 8 Region: 290-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000015012
Domain Number - Region: 422-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family EGF-type module 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015012   Gene: ENSSSCG00000014117   Transcript: ENSSSCT00000015421
Sequence length 944
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:90502275:90549368:1 gene:ENSSSCG00000014117 transcript:ENSSSCT00000015421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLATRGAALLLLHLALQPWLAAGAQATPQAFINLPSASQRLNPSVLQPILSDPTLNELYV
ISTFKLQTKSSATIFGLYSSADNSKYFEFTVMGRLNKAILRYLKNDGKIHLVVFNNLQLA
DGRRHRLLLRLTNLHRGAGSVELYLDCTQVDSIHNLPRAFAGLSQSPGSVELRTFQRKAQ
DSLEELKLVVRGSLFQAASLQDCFLQQSEPLAATNTGDFNRQFLGQMSQLNQLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVAPAPPASPTPPVRRCDSNPCFRGVR
CTDTRDGFQCGPCPEGYTGNGVTCSDVDECRYHPCYPGVRCVNLAPGFRCDACPVGFTGP
TVQGVGINFAKTNKQVCTDIDECRNGACVLNSICVNTLGSYRCGPCKPGYIGDQMRGCKM
ERNCRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSAR
NCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLTHNMDQRNSDKDIYG
DACDNCRNVLNNDQRDTDGDGKGDACDDDMDGDGIKNILDNCPKVANRNQQDRDGDGVXD
ACDSCPDVSNPNQVSRAQGNPGSRLNSPRQRLSAGLQGEADPKILFPCGLQTEARSWASP
CRGEGVAGFLPSSSPPAPGDGVGDICETDFDQDQVIDRIDVCPENAEVTLTDFRAYQTVV
LDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAG
FIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTG
DTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMR
GGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRLDN
Download sequence
Identical sequences ENSSSCP00000015012 ENSSSCP00000015012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]