SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015013 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015013
Domain Number 1 Region: 159-374
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-107
Family Thrombospondin C-terminal domain 0.000000101
Further Details:      
 
Domain Number 2 Region: 32-157
Classification Level Classification E-value
Superfamily TSP type-3 repeat 7.59e-35
Family TSP type-3 repeat 0.00000517
Further Details:      
 
Domain Number 3 Region: 1-35
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000102
Family TSP type-3 repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015013   Gene: ENSSSCG00000014118   Transcript: ENSSSCT00000015422
Sequence length 392
Comment pep:known chromosome:Sscrofa10.2:2:90747286:90761759:-1 gene:ENSSSCG00000014118 transcript:ENSSSCT00000015422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGDGIKNILDNCPKVANRNQQDRDGDGVGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQ
DSDGDGHQDSTDNCPTVINSAQLDTDKDGIGDECDDDDDNDGIPDLVPPGPDNCRLVPNP
GQEDSNSDGVGDICETDFDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLDPEGDAQIDPN
WVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFY
VVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKD
SRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGRLGVFCFSQE
NIIWSNLKYRCNDTIPEDFQEFQTQNFDRLDN
Download sequence
Identical sequences ENSSSCP00000015013 ENSSSCP00000015013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]