SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015120 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015120
Domain Number 1 Region: 497-698
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-22
Family SPRY domain 0.0065
Further Details:      
 
Domain Number 2 Region: 192-255
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.14e-16
Family B-box zinc-binding domain 0.00098
Further Details:      
 
Domain Number 3 Region: 420-500
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000333
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 4 Region: 13-50
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000138
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000015120
Domain Number - Region: 137-187
Classification Level Classification E-value
Superfamily RING/U-box 0.035
Family ZZ domain 0.036
Further Details:      
 
Domain Number - Region: 239-329
Classification Level Classification E-value
Superfamily Prefoldin 0.068
Family Prefoldin 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015120   Gene: ENSSSCG00000014214   Transcript: ENSSSCT00000015532
Sequence length 717
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:124120211:124154475:-1 gene:ENSSSCG00000014214 transcript:ENSSSCT00000015532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGDGSDSLVTIKNIERELICPACKELFTHPLILPCQHSICHKCVKELLLMLDDSFNEVG
SDNSNQSSPRIRLPSPSMDKIDRISRPGWKRNSLTPRTTTFPCPGCEHDVDLGERGINGL
FRNFTLETIVERYRQAARAATAIMCDLCKPPPQESTKSCMDCSASYCNECFKIYHPWGTI
KAQHEYVGPTTNFRPKILMCPEHETERINMYCELCRRPVCHLCKLGGNHSNHRVTTMSSA
YKTLKEKLSKDIDYLIGKESQVKSQISELNLLMKETECNGERAKEEAVTHFEKLFEVLEE
RKSSVLKAIDTSKKLRLDKFQTQMEEYQGLLENSGLVGYAQEVLKETDQSCFVQTAKQLH
LRIQKATESLKSFRPAAQTSFEDYVVNTSKQTELLGELSFFSSGVDVPEINEEQSKIYNN
ALINWYHPGKDKADSYVLEYRKINRDEEMLSWNETEVFGTSKVISDLESNCNYAFRVRAY
KGSICSPCSRELILHTPPAPVFSFLFDEKCGYNNEHLLLNLKRDRVESRAGFNLLLAAER
IQVGYYTSLDYIIGDVGITKGKHFWAFRVEPYSYLVKVGVASSDKLQEWLRSPRDAVSPR
YEQDSGHDSGSEDACFDSSQPFTLVTIGMKKFFIPKSPTSSNEPENRVLPMPTSIGVFLD
YDKGKVGFYDMDHMKCLYERQVDCSHTMYPAFALMGSGGIQLEEPITAKYLEYQENM
Download sequence
Identical sequences A0A287AB27
ENSSSCP00000015120 XP_003480940.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]