SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015505 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015505
Domain Number 1 Region: 831-943
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.05e-23
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 2 Region: 318-436
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.38e-18
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 119-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000373
Family EGF-type module 0.017
Further Details:      
 
Domain Number 4 Region: 279-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000648
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 47-78,124-162,191-246
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000463
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 6 Region: 650-811
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000824
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015505   Gene: ENSSSCG00000014575   Transcript: ENSSSCT00000015925
Sequence length 1021
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:457731:521012:1 gene:ENSSSCG00000014575 transcript:ENSSSCT00000015925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YTHTHTPVWMYLVIGKGSGPGHPGLRTPYQELPCCFADVDGYAQGVDDCHTNALCQNTPT
SHKCSCGPGYQGEGRRCEGLRSCIRFNGEKKRHAGNAVSATLCTRLSGRFHAAHEGRDCL
DADECLRDNGGCQHSCVNLMGSYECRCKEGFFLSDNQHTCIHHSEGTSALPGFSPSARQG
HGEVGGGSSAPCSRGFFLFKQSRHLLILTCGHGNGGCQHSCEDTAAGPECSCHPQSELHV
DGRSCPERPDTALEVTEGSATSMADGDKRVKRRLLMETCAVGNGGCDRTCKDTATGVRCS
CPIGFTLQPDGKTCRDVDECQTRNGGCDHVCRNTAGSFDCSCRKGFKLLTDEKSCQDVDE
CSLERTCDHSCINRPGSFACACNAGYTLYGFTHCGDTDECSVHNGGCQQVCVNTVGGYEC
QCLSGHTLHWNGKDCVEAEGAVAAGASPRVSLQCTRSAGGDRCSLSCRSGIHLSSGLQEA
YSVTCGSSSPPRSKQRESAGSASGEDVASVRTSVTFKLNGGICSLKKAEPFPEGLRPAPP
EEHSSVKESFRYANLTCSSRKQVPGAPGRPSAPEDVFVTVEFELETNQKEVTASCDLSCV
IKRTERRLRKATRTLRKAAQREQFHLQLVGMDLQVAKRSPGTAGPQAESCAVGQGRVGSQ
CVSCRAGTYYDGAQERCILCPDGTFQNEEGQITCEPCPRPENPGVQKTPEAWNVSECGGL
CQPGEYSADGFAPCQLCALGTFQPEAGRTSCLPCGGGLPTKRLGATSFQDCETRVQCSPG
HFYTTTHRCVRCPAGTYQPEFGKNSCVSCPGNTTTDFDGATNLTQCKNRRCGGELGDFTG
YIESPNYPGNYPANAECTWVINPPPKRRILVVVPEIFLPIEDDCGDFLVMRKTASRGSAT
TYETCQTYERPIAFTSRSRRLWIQFKSNEGNSAKGFQVPYVTYDEDYQELIEDIVRDGRL
YASENHQEILKDKKLIKALFDVLAHPQNYFRYTAQESREMFPRSFIRLLRSKVSRFLRPY
R
Download sequence
Identical sequences ENSSSCP00000015505 ENSSSCP00000015505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]