SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015599 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015599
Domain Number 1 Region: 294-489
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-42
Family SPRY domain 0.0000779
Further Details:      
 
Domain Number 2 Region: 4-92
Classification Level Classification E-value
Superfamily RING/U-box 5.08e-27
Family RING finger domain, C3HC4 0.0045
Further Details:      
 
Domain Number 3 Region: 88-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.11e-16
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015599   Gene: ENSSSCG00000014670   Transcript: ENSSSCT00000016021
Sequence length 492
Comment pep:known chromosome:Sscrofa10.2:9:4724246:4737190:1 gene:ENSSSCG00000014670 transcript:ENSSSCT00000016021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGILENIREEVTCPICLELLKEPLSLDCGHSFCQDCLTVNSKKSMMGLEGKSNCPVCR
VSYQPGNLRLNRHVANIVERLRKVSLSPEVEQKGNLCVHHEEKLLFFCKEDGKVICWICE
RSQQHCDHQTFLVEEVAQEYQKKLQDALERLQEEQKEAEKLEAQVREEVSAWKNQIQSEQ
QNVQAEFMRLRGILENEELKEMQMLKDEEKVILSDLADSKDELAQQTQLVGELISEVERR
LLGSKLEMLQDVNDILKRSETLTLKKPKAFPKEQRRVFRAPDLREILCVFNKLTDVRRYW
VHVTLNNLKIKSDVTISVDRRQVRYARKFGLSSTCPNGDFEDCSVLGYPLISSGKHYWEV
DVSGKRAWILGVYGRKLSNCLFCFSKSNQHPYWRYKPKYGYWVIWLNDKGEYNTFEESSS
SDSGPLTLSLGVPPRRIGVFLEYEAGTVSFFNITNHGSLIYRFSSCPFSQATFPYFNPMK
CHIPMILCSPGS
Download sequence
Identical sequences F1RLV7
9823.ENSSSCP00000015599 ENSSSCP00000015599 ENSSSCP00000015599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]