SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015601 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015601
Domain Number 1 Region: 637-829
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-48
Family SPRY domain 0.0000319
Further Details:      
 
Domain Number 2 Region: 25-116
Classification Level Classification E-value
Superfamily RING/U-box 5.05e-29
Family RING finger domain, C3HC4 0.0058
Further Details:      
 
Domain Number 3 Region: 118-180
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.39e-17
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 4 Region: 364-424
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000113
Family RING finger domain, C3HC4 0.0083
Further Details:      
 
Domain Number 5 Region: 431-495
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000549
Family B-box zinc-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015601   Gene: ENSSSCG00000014672   Transcript: ENSSSCT00000016023
Sequence length 831
Comment pep:known chromosome:Sscrofa10.2:9:4689735:4720219:1 gene:ENSSSCG00000014672 transcript:ENSSSCT00000016023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAHLPRILYARSTFEARAGQAGAGRVATMTSAVLVDIQEEVTCPLCLELLTDPLSIDCGH
SFCQACITQNSEEWRMDQGGESSCPVCQTRYRPGNLRPNRHLANIAERLREVVLGSGTQL
KVILCAHHGEKLQLFCREDGQLICWLCERAQEHRGHHTFLMEEVAQEYQERFQESLKKLR
QEQQEAEKLAALIREKRASWKNQMEPERHRIQKQFDQLRSILDKEEQRQLRKLEEEERKG
LSVIAEAEGELLQQSQSLRELISDLERRCQGSMTELLQDVRDVAERSEFWTLKKPEALPT
KLKSVFRAPDLKKMLRVFRELTDVQSYWGKQGKCSTNTRRASVVWTGRSEGGSSCYGFTH
PVITQKGVSCSVCWELSTEPLRLGCGHGFCPACISDSREARGCPVCGVSYSLGNQRLPSI
VEHPREVGMSPEDGWKEDLCRKHGKKLLLLCREDREVFCLCCEKTQEHRDHHLCLIRDAA
KECQEMLQAALRRLQKEQQKAEELEADIREQRTSCKYQMQTERQRIRSEFNQLRCILDCE
ERRELQKLEEEERKTLDNLAAAEAELVQQTWLLKDLISDLECRREWPTQELLQDTSGTMK
WGEIWTLRKPKLVSKKLRRVFRAPDLGAMLQAQRELTHVQCYWEDITLDPFNLNLNLVLS
EDQRQVISVPIWPVKCYNYGVLGSQYFSSGKHYWEVDVSKKTAWVLGVYCRARSCTAELA
LGRGAEHQNAHAIYRPQCGYWVIGLKNAFKYKAFEDASTCDLNVLTLSGAVPPLRVGVFL
DCEAGTVSFFNVTNYGSLIYRFSKCSFSQNVYPYFNPWNCPAPMTLCPPSS
Download sequence
Identical sequences ENSSSCP00000015601 ENSSSCP00000015601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]