SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015688 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015688
Domain Number 1 Region: 295-480
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-66
Family SPRY domain 0.00000393
Further Details:      
 
Domain Number 2 Region: 7-84
Classification Level Classification E-value
Superfamily RING/U-box 3.31e-22
Family RING finger domain, C3HC4 0.0067
Further Details:      
 
Domain Number 3 Region: 91-153
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000153
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015688   Gene: ENSSSCG00000014768   Transcript: ENSSSCT00000016119
Sequence length 485
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:6136129:6143878:1 gene:ENSSSCG00000014768 transcript:ENSSSCT00000016119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPAALMEAVVEEVACPICMTFLKEPVSIDCGHSFCHSCLSGLWEVPGEAPNWGYSCPLC
RAPVQPRNLRPNWQLANVAEKIRRLGLHPGMGLKGDVCEPHGQQLRMFCQEDGLLMCEAC
SRAPEHEAHRVLPMEDVAWDYKWKLHEALEHLRKEHEEAWKLEVGERKRTANWKIQVETR
KQSIMWEFEKYRRLLKKKQPPGRRLEVEAAAALASLEQEEGETARKLELNHDALIQQSRV
LWRMIAELEDRSQRPVRWMLQGIQDVLNRSQSWRLQRPEPVSLELKTDCRVPGLREILKT
FAADVRLDPDTAYSRLIVSEDRNGVRYGDTKQKLPDNPERFYRYNIVLGSQCISSGRHYW
EVEVGDRSEWGLGVCRESVDRKEVVYLSPHYGFWVIRLRKGSEYRAGTDEYPLLSLPVPP
RRVGVFLDYEAHDISFYNVTDNGAHIFTFPHYPFPGRLLPYFSPCYSIGANNTAPLTICS
LDGED
Download sequence
Identical sequences ENSSSCP00000015688 ENSSSCP00000015688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]