SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015699 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015699
Domain Number 1 Region: 279-465
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-69
Family SPRY domain 0.0000000425
Further Details:      
 
Domain Number 2 Region: 9-78
Classification Level Classification E-value
Superfamily RING/U-box 5.7e-23
Family RING finger domain, C3HC4 0.0086
Further Details:      
 
Domain Number 3 Region: 87-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.98e-18
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015699   Gene: ENSSSCG00000014780   Transcript: ENSSSCT00000016131
Sequence length 469
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:6536121:6543906:1 gene:ENSSSCG00000014780 transcript:ENSSSCT00000016131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASALPLARMWDEVTCSICLDPMVEPVSIECGHSFCQECISEVGKDGGSVCPVCRQHFLL
RNLRPNRQVANMVDNLKEMSQGVKEGPQWELCAVHGEKLHLFCKDDGKVLCWVCSQSRKH
RDHTMVPIEEAAQEYQEKLQVALEKLRNKQEQAEKLEADIATKRAAWKGKVEAHKLRIHE
EFVRQKNFLAEEEQRQLQKLEEEEREQLKALGATEARLAQQSQALQELIAELERRSRGPM
LELLQEVKSVLERSESWNLKELNIGFPDLSSLCYVPGIKRMLRSYAVHITLDPLTASPWL
VLSENRRQVRLGETRQEVPENEERFDTYPMVLGAQHFNSGKHYWEVDVAGKEAWDLGVCR
DSVKRKGHFLLNPSNGFWTIWLWNKQKYEAGTCTQTPLYPQVPPSRVGIFLDYDASTVSF
YNISDHGSLIYSFSECAFAGPVRPFFNPGFNDGGRNAPPLTLCPLRTGW
Download sequence
Identical sequences ENSSSCP00000015699 ENSSSCP00000015699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]