SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015710 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015710
Domain Number 1 Region: 289-640,673-749
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 9.16e-165
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000643
Further Details:      
 
Domain Number 2 Region: 7-135
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 7.32e-27
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015710   Gene: ENSSSCG00000014791   Transcript: ENSSSCT00000016142
Sequence length 789
Comment pep:novel chromosome:Sscrofa10.2:9:6818049:6840330:-1 gene:ENSSSCG00000014791 transcript:ENSSSCT00000016142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWFGSSDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA
AETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLFNYINPHNGKHSPMVARST
LDIVLANKDKIQCFIILKCIFPELFCNTHVCVRAYIYFQGGNKTDRPNSAYFPEECAAEC
TGSLIQCYRQGSWLLEPVSRGYVGTLITSEFMNFSLMYLKQSMGTSIRPPTFLTFKESKL
ITVKGKAIFFGLCTHTCKVSWTPTEEEAPSLVYCVAWHKYSVSLIPRFLHRPGAFAIYLE
PWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEV
WGEEFEKLYESYERQGHVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNLGT
IKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFTKLAEVTKVIVRNLNKIID
INYYPIPEASLSNKRHRPIGIGVQGLADAFILMRYPFESPEAQLLNKQIFETIYYGALEA
SCDLAKEYGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKLLKEKIAKYGIRNSLLIAPM
PTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWNEEMKNQIIAC
NGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTS
MHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEKERNTAAMVCSLEN
RDECLMCGS
Download sequence
Identical sequences ENSSSCP00000015710 ENSSSCP00000015710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]