SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015762 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015762
Domain Number 1 Region: 186-252
Classification Level Classification E-value
Superfamily FnI-like domain 4.71e-16
Family VWC domain 0.0049
Further Details:      
 
Domain Number 2 Region: 45-112
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000706
Family VWC domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000015762
Domain Number - Region: 3-33
Classification Level Classification E-value
Superfamily FnI-like domain 0.00439
Family VWC domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015762   Gene: ENSSSCG00000014843   Transcript: ENSSSCT00000016195
Sequence length 366
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:10070248:10088542:-1 gene:ENSSSCG00000014843 transcript:ENSSSCT00000016195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSAHVSCYRLHCPPVHCSQPVTEPQQCCPRCVEPHTPSGLRAPPRSCQHNGTMYQQGEIF
SAHELLPSRLPNQCVLCSCTEGQIYCGLMTCPEPGCPAPLPLPASCCQVCKDGSGEKSSE
EDTTEPHPGARHSQDPCSGDGGRKRGLGTPTPTGPSAPLGFIPRHFRPKEAGSTTVKIVL
KEKHKKACVHGGKTYSHGEVWHPAFRSFGPLPCILCTCQDGRQDCQRVTCPTEYPCHRPE
KVAGKCCKICPEDKADPGPSEVSTTRCPKAPGRVLVHTSVSPSPDNLRRFALEREASEQV
EIYLWKLVKGIFHLIQIKKVRKQDFQKEAQNFRLLTGTHEGHWNVFLAQTPELKVTASPD
KETKTL
Download sequence
Identical sequences ENSSSCP00000015762 ENSSSCP00000015762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]