SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015795 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015795
Domain Number 1 Region: 38-378
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.29e-120
Family Calpain large subunit, catalytic domain (domain II) 0.000000114
Further Details:      
 
Domain Number 2 Region: 387-531
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.7e-38
Family Calpain large subunit, middle domain (domain III) 0.00012
Further Details:      
 
Domain Number 3 Region: 553-648
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.58e-17
Family Synaptotagmin-like (S variant) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015795   Gene: ENSSSCG00000014875   Transcript: ENSSSCT00000016228
Sequence length 673
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:12302387:12341085:1 gene:ENSSSCG00000014875 transcript:ENSSSCT00000016228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAQEGISSPLPPGAPGAARRCLASASPPGAAATMFSCVKPYEDQNYSALKRACLRRKVLF
EDPHFPATDDSLYYKSTPGPTVRWKRPKDICEDPHLFVDGISSHDLHQGQVGNCWFVAAC
SSLASRESLWQKVIPDWKEQEWDSEKPNAYAGIFHFHFWRFGEWVDVVIDDRLPTVNNQL
IYCHSNSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDFAND
EAKRNQLFERMLKVHSRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHG
LLAFFKSEKLDMIRLRNPWGEREWNGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTF
EDVCRYFTDIIKCRLLNTSYLSIHKTWEEARLRGAWTRHEDPLQNRSGGCINHKNTFFQN
PQYIFDVKKPEDEVLICIQQRPKQSTRRDGKGENLAIGFDIYKVEENRQYRMHSLQHRAA
SSIYINSRSVFLRTEQPEGRYVIIPTTFEPGHTGEFLLRVFTDVPSDCRELRLDEPPRSC
WSSLCGYPQQVTQVHVLRATGLKDSPTGADSYVIIKCEGDKVRSAVRRGTSTPEYDVKGV
FYRKKPSQPITVQIWNHRVLKDEFLGQVHLKANPDDLQALHTLHLRDRSSQQPSDLPGTV
AVCILSSASLTAV
Download sequence
Identical sequences 9823.ENSSSCP00000015795 ENSSSCP00000015795 ENSSSCP00000015795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]