SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015813 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015813
Domain Number 1 Region: 2-141,294-461
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.1e-68
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015813   Gene: ENSSSCG00000014892   Transcript: ENSSSCT00000016247
Sequence length 497
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:13929183:13932230:1 gene:ENSSSCG00000014892 transcript:ENSSSCT00000016247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFRHCVLRLTENNSQPLMTKLQWLFAFLEHSQRPAISPENFLSASWTPWFSPGTQQDCSE
YLKYLLDRLHEEEKTGTRICQKLKQSSSPSAPEEPPSPSSTSVEKMFGGKIVTRICCLRC
LNVSSREEAFTDLSLAFPPAERCRRRRLGSVMLPPEEVGPRDLPLPSRAQGPGKVGPRRQ
RKHCITADVPPAILDMAGLGHQGPGGQSLQEEKGEKEERAEEEEETRKGEDEREKGEPKG
EEEEEEEEKEAEEKEAEEKKEEVMEKKEMEKEADSLGPGTLRNAAVPSAEGSRSVLDLVN
YFLSPEKLTAENRYHCESCASLQDAEKVVELSQGPRYLILTLLRFSFDLRTMRRRKILDD
VSIPLLLRLPLAGGRGQAYDLCSVVVHSGVSSESGHYYCYAREGAARPAPSLGAADRPEP
DNQWYLFNDTRVSFSSFESVSNVTSFFPKDTAYVLFYRQRPGEGPEAEPGSPRARAEPAL
HKDLMEAISKDNILYLQ
Download sequence
Identical sequences ENSSSCP00000015813 ENSSSCP00000015813 9823.ENSSSCP00000015813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]