SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015844 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015844
Domain Number 1 Region: 152-458
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.05e-86
Family Papain-like 0.00000000165
Further Details:      
 
Domain Number 2 Region: 25-142
Classification Level Classification E-value
Superfamily Dipeptidyl peptidase I (cathepsin C), exclusion domain 6.41e-47
Family Dipeptidyl peptidase I (cathepsin C), exclusion domain 0.000000498
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015844   Gene: ENSSSCG00000014924   Transcript: ENSSSCT00000016280
Sequence length 463
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:24081771:24116601:-1 gene:ENSSSCG00000014924 transcript:ENSSSCT00000016280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRLGSLLSALLLLLYVAGTAHCDTPANCTYPDLLGTWIFHVGPGGSQRDVNCSVMGPP
EKKVVVHLKKLDTAYDDFGNSGRFTIIYNQGFEIVLNDYKWFAFFKYKEEGRKVTSYCNE
TMTGWVHDVLGRNWACFTGEKAGNTFEKVNVNTAHLKSRQKKYSNRLYKYNHDFVKAING
IQKSWTATAYMEYETLTLKEMTQRGGGYNQRLPRPKPAPITAEIQEKSLHLPASWDWRNV
RGTNFVTPVRNQASCGSCYSFASMGMMEARIRILTNNTQTPILSPQEVVSCSQYAQGCAG
GFPYLIAGKYAQDFGLVEEACFPYTGTDSPCTVKEGCFRYYSSEYHYVGGFYGGCNEALM
KLELVHHGPMAVAFEVYDDFLHYRKGIYHHTGLRDPFNPFELTNHAVLLVGYGTDLASGM
DYWIVKNSWGTSWGEDGYFRIRRGTDECAIESIAVAATPIPKL
Download sequence
Identical sequences F1STR1
XP_003129789.1.46622 ENSSSCP00000015844 9823.ENSSSCP00000015844 ENSSSCP00000015844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]