SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015849 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015849
Domain Number 1 Region: 215-385
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-46
Family SPRY domain 0.00012
Further Details:      
 
Domain Number 2 Region: 22-85
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000198
Family B-box zinc-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015849   Gene: ENSSSCG00000014928   Transcript: ENSSSCT00000016285
Sequence length 387
Comment pep:novel chromosome:Sscrofa10.2:9:25556418:25562438:1 gene:ENSSSCG00000014928 transcript:ENSSSCT00000016285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQTNIVLKRLASLARQARASHSSSSEEQLCGTHREAKGLFCEADKTLLCGPCSEGPEHAA
HSHSPIQWAAEERREMLLKRMDSLWKMTQEMQNNRNQETKKIRSLEDYVTLRKVMIKLQY
QRMHLFLREEEQFHLEALEKEAKETGRDLKESVFRMTQQKETLKEMYSMLTELCRSPDTE
LLQDLENVLEMTELVQMQNPQPVNPELTCWPVTGMLDMLNNFRAENVLSQKMSIHSVRLS
EDEASVVFEDDPQGASSEPPSEERFVAWGAQAFTSGRHYWEVDVTRSSNWILGVCKDIWT
SDTDISVDSEDAFLLFSMKVNDQYTLSTNSPPLIQYVQRPLGRVGVFLDYDNGTVSFYDV
CKGSLIYSFLPSSFSSPLRPFLCLRSP
Download sequence
Identical sequences ENSSSCP00000015849 ENSSSCP00000015849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]