SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015851 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015851
Domain Number 1 Region: 279-448
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-45
Family SPRY domain 0.00013
Further Details:      
 
Domain Number 2 Region: 7-81
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-20
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 87-149
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000305
Family B-box zinc-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015851   Gene: ENSSSCG00000014930   Transcript: ENSSSCT00000016287
Sequence length 451
Comment pep:novel chromosome:Sscrofa10.2:9:25572372:25578578:-1 gene:ENSSSCG00000014930 transcript:ENSSSCT00000016287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSEGFMHTFQDELKCSICMNYFIDPVTTDCGHSFCRPCLYLCWEEEQAPKSCPECRAVS
EKPDFKTNIVLKRLASLARQARASHSSRSEEQLCGTHREAKGLFCEADKTLLCGPCSEGP
EHAAHSHSPIQWAAEERREMLLKRMDSLWKMTQEMQNNRNQETKKIRSLEDYVTLRKVMI
KLQYQRMHLFLREEEQFHLEALEKEAKETGRDLKESVFRMTQQKETLKEMYSMLTELCRS
PDTELLQDLENVLEMTELVQMQNPQPVNPELTCWPVTGMLDMLNNFRAENVLSQKMSIHS
VRLSEDEASVVFEDDPQGASSEPPSEERFVAWGAQAFTSGRHYWEVDVTRSSNWILGVCK
DIWTSDTDISVDSEDAFLLFSMKVNDQYTLSTNSPPLIQYVQRPLGRVGVFLDYDNGTVS
FYDVCKGSLIYSFLPSSFSSPLRPYLFFSSP
Download sequence
Identical sequences ENSSSCP00000015851 ENSSSCP00000015851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]