SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015856 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015856
Domain Number 1 Region: 3821-4001
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-35
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 2 Region: 1140-1245
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-29
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 3124-3235
Classification Level Classification E-value
Superfamily Cadherin-like 7.59e-29
Family Cadherin 0.0022
Further Details:      
 
Domain Number 4 Region: 3334-3445
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-29
Family Cadherin 0.00074
Further Details:      
 
Domain Number 5 Region: 3228-3332
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-28
Family Cadherin 0.00093
Further Details:      
 
Domain Number 6 Region: 2807-2915
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 7 Region: 1028-1146
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 8 Region: 459-577
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 9 Region: 2279-2385
Classification Level Classification E-value
Superfamily Cadherin-like 4.84e-27
Family Cadherin 0.00095
Further Details:      
 
Domain Number 10 Region: 929-1032
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 11 Region: 1553-1662
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 12 Region: 3022-3130
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 13 Region: 145-267
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 14 Region: 1762-1882
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 15 Region: 2587-2724
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-24
Family Cadherin 0.0036
Further Details:      
 
Domain Number 16 Region: 824-927
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-24
Family Cadherin 0.00065
Further Details:      
 
Domain Number 17 Region: 1453-1557
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-23
Family Cadherin 0.00076
Further Details:      
 
Domain Number 18 Region: 2916-3021
Classification Level Classification E-value
Superfamily Cadherin-like 4.97e-22
Family Cadherin 0.0018
Further Details:      
 
Domain Number 19 Region: 732-822
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 20 Region: 2071-2179
Classification Level Classification E-value
Superfamily Cadherin-like 9.68e-22
Family Cadherin 0.0028
Further Details:      
 
Domain Number 21 Region: 1665-1768
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-21
Family Cadherin 0.002
Further Details:      
 
Domain Number 22 Region: 2489-2599
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-20
Family Cadherin 0.0041
Further Details:      
 
Domain Number 23 Region: 1241-1356
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-20
Family Cadherin 0.0031
Further Details:      
 
Domain Number 24 Region: 2386-2486
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 25 Region: 3433-3552
Classification Level Classification E-value
Superfamily Cadherin-like 7e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 26 Region: 2179-2286
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-19
Family Cadherin 0.0029
Further Details:      
 
Domain Number 27 Region: 1870-1993
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-19
Family Cadherin 0.002
Further Details:      
 
Domain Number 28 Region: 1979-2083
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000143
Family Cadherin 0.0026
Further Details:      
 
Domain Number 29 Region: 1360-1459
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000209
Family Cadherin 0.013
Further Details:      
 
Domain Number 30 Region: 570-671
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000138
Family Cadherin 0.0026
Further Details:      
 
Domain Number 31 Region: 2704-2813
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000214
Family Cadherin 0.0036
Further Details:      
 
Domain Number 32 Region: 374-471
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000271
Family Cadherin 0.0084
Further Details:      
 
Domain Number 33 Region: 3546-3636
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000314
Family Cadherin 0.0046
Further Details:      
 
Domain Number 34 Region: 41-157
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000471
Family Cadherin 0.0059
Further Details:      
 
Domain Number 35 Region: 270-364
Classification Level Classification E-value
Superfamily Cadherin-like 0.000006
Family Cadherin 0.008
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000015856
Domain Number - Region: 4017-4049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0446
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015856   Gene: ENSSSCG00000014935   Transcript: ENSSSCT00000016292
Sequence length 4588
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:28144709:28725103:1 gene:ENSSSCG00000014935 transcript:ENSSSCT00000016292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDITMGYCVGTRPPSCLILLLLKLLATVSQGLPGSGPLGFHFTHSIYNATVYENSAARTY
VNSQSRMGITLIDLSWEIKYRIVSGDEEGFFKAEEVIIADFCFLRIRTKGGNSAILNREI
QDNYLLIVKGSVRGEDLEAWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQVT
ATDADIGSNGEFYYYFKNKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKLY
GNNGVSSTAKLYVHVERINEHAPTLHVVTHIPFSLDTEPVYAVVTVDDLDEGANGEIESV
SIVAGDPLDQFFLAKEGKWMNEYRIKEKKQVDWESFPYGYNLTLQAKDKGSPQKFSAAKV
VHIANPKRDFVPVKFEKETYEVSISEFSPPGVMVAIVKLSPEPLDVEYKLSPGADAQYFK
INPRSGLIVTAQPLNTIKKEVYKLGVTNKEGDLKAQVTIGIEDANDHTPEFQQPLYDAFV
NESVPVGTSVLTVSASDKDKGENGYITYSIASLNLLPFAINQFTGVISTTEELDFESSPE
TYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVGCQGVISYDFPVGGHITAVS
AIDIDELELVKYKIISGNELGFFYLNPDSGVLQLKKSLMNSGIKNGNFALRITATDGEHF
ADPMSVNISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSVNRQ
GPHFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETG
QLKVLMPMDREHRDLYLLNITIYDLGNPQRSSWRLLTINVEDANDNSPVFLQDSYSVTIL
ESSSIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANYS
LKIEARDKAESGQQLFSVVTLEVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETH
DPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSL
SSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTAHDEDSGRDGEIQYS
IRDGSGLGRFNIDDESGVISTADILDRETTGSYWLTVYATDRGVVPLYSTIEVYIEIEDV
NDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINSK
TGLITTTSRKLDREQQAEHFLEVTVTDGGFSPKQSTIWVVVQVLDENDNKPQFPEKVYQI
KLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFTA
GSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPVPLTFDEPFYNFTVMESDRVTEIV
GVVSVQPANTPLWFDIVGGNFDSSFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTDGTNV
AVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRDEKHKLSYTIHSSI
DSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNVMVRDQEFPYRRNLARVIVNVEDAND
HSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNTFKIEPVLG
IITVSKEPDMTTMGQFVLSVKVTDQGSPPMSATAIVRISVTMSDNSHPKFTHKDYQAEVN
ENVDIGTSVILISAISQSTLIYEVKDGNVDGIFTINPYSGVITTRKALDYEHTSSYQLIV
QATNMAGMASNVTVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRAT
DADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQL
TAESPVEVNIEVTDVNDNPPVFTQAVFETVLLLPTYVGVEVLKVSAVDPDSEVPPELTYS
LMEGSLDHFLIDSSTGVLTIKNNNLSKDHYLLIVKVSDGKFYSTSMVNILVKEAMDSGLH
FTQSFYSTSISENNSNITKVAIVNAVGNRLNEPLKYSILNPGNKFKIKSTSGVIQTTGVP
FDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPGT
QIYRVTAIDKDKGANGEVTYVLQDDYGHFEINPTSGNVILKEAFNSDLSNIEYGVTILAK
DGGKPSLSTSVELPITIVNKAMPVFDKPFYTASINEDVSVDTPILSINATSPEGQGIIYI
IIDGDLYKQFNIDFDTGVLKVVSPLDYEIISVYKLTVRASDALTGARAEVTVDLLVNDIN
DNPPIFDQPTYNTTLSEASLIGTPVLQVVSTDADSENNKMVHYQIVQDTYNSTDYFHIDS
ASGLILTARMLDHELVQHCTLKVRATDSGFPSLSSEVLVHIYISDVNDNPPVFNQLIYES
YVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDGKSGVITLSNHRKQRM
EPLYSLNVSVSDGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENAAAGTKVIHVRAT
DGDPGTYGQISYAIINDFAKDRFLIDGNGQVITTERLDRENPLEGDISIFLRALDGGGRT
TFCTVRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQAMDPDDGANARITYSLYS
EASVSVADLLEIDPDNGWMVTKGHFNQLKNTVLSFFVKAVDGGIPVRHALIPVYIHVLPP
ETFLPSFTQSQYSFTVSEDTAIGSTVDTLRILPTQSVRFSTVNGERPENNQGGVFIIEQE
TGTIKLDKRLDHEISPAFHFKVAATIPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYET
IIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDL
DHETDPAFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAHEVYRGNVKESDPPGE
VVAVLSTWDRDTSDINRQVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDMYFLN
ITATDGLFVTQAMVEVTVSDVNDNSPVCDQVAYTAVFPEDIPSNKIILKVSAKDADIGSN
GDIRYSLYGSGNNEFFLDPESGELKTLARLDRERIPVYNLVARATDGGGRFCQSDIRLIL
EDVNDNPPVFSSDHYNACVYENTATKALLTRVQAMDPDVGINRKVVYSLADSANGFFSID
GSSGIVILEQPLDREQQSAYNISVRATDQSPGQALSSLATVTITVLDINDNPPVFERRDY
LVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNEQGKFRIHPKTGGISVSEILDY
ELCKKFYLVVEAKDGGTPALSAVATVSINLTDVNDNPPRFSQDVYSAVISEDALVGDSVI
LLIAEDADSQPNGQIRFSIVNGDRDSEFAVDPVLGLLKVKKKLDRERVSGYSLLVQAVDS
GIPAMSSTATVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLMVTDRDSFHNGPP
FSFSILSGNEEEAFVLDSHGILRSAVVFRHTESLEYVLCVQAKDSGKPQQASHSYIRVRV
IEESTHKPTAIPLEIFIVTMEDDFPGGVIGKIHATDQDMYDVLTFALKSEQKSLFKVNSH
DGKIIALGGLDSGKYVLNVSVSDGRFQVPIDVVVHVEQLVHEMLQNTVTIRFENVSPEDF
VGLHMHGFRRTLRNVVLTQKQDSLHIISIQPVAGTNQLDMLFAVEMHSSEFYKPAYLIQK
LSNARRHLENVMRISAILEKNCSGLDCQEQHCEQGLSLDSHALMTYSTARISFVCPRFYR
NVRCTCNGGLCPGSNDPCVEKPCPGDMQCVGYEASRRPFLCQCPPGKLGECSGHTSLSFA
GNSYIKYRLSENSKEEDFKLALRLRTLQSNGIIMYTRANPCIILKIVDGKLWFQLDCGSG
PGILGISGRAVNDGSWHSVFLELNRNFTSLSLDDSYVERRRAPLYFQTLSTESTIYFGAL
VQADNIRSLTDTRVTQVLSGFQGCLDSVVLNNNELPLQNKRSSFAEVVGLTELKLGCVLY
PDACERSPCQHGGSCTGLPSGGECTCALGTPALPGLRGRDKAGWARGRPAGGLALTSLTI
PRALLYTGGALERALKTCELQEKPRCGLCVNVEIEHHSMSNSGYTATNCNILLTMAGRCF
CWQSYGLPQWVSFKIIIIIIIIIIIITVLTNNKVIKKRARVSVIDSPGDRLLSQIATILA
PGPCSRVCRGFKAGNPQQEISLSPSCPENPRKSSHIVCSGSNSKMFLHRLSPDSNGPLLE
KSLVVVKGKGELTCLRHPMTMSEEPSTWSLRCTGDIGHLELNGKEAVHEDKGVDDPGEVT
CFAGSNKGSNSEVQSLSSFQSDSGDDNASIVTVIQLVNNVVDTIENEVSVMDQGQNYNRA
YHWDTSDWMPGARLSDIEEVPNYENQEGGSAHQGSTRELESDYYLGGYDIDSEYPPPHEE
EFLSQDQLPPPLPEDFPDQYEALPPSQPVSLASTLSPDCRRRPQFHPSQYLPPHPFPNES
DLVGAPAACEFSTFAVSMNQGTEAAAAGPADSGSLSLHNSRGTSSSDVSASCGFDDSEVA
MSDYESVGELSLASLHIPFVETQHQTQV
Download sequence
Identical sequences ENSSSCP00000015856 ENSSSCP00000015856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]