SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015974 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015974
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.25e-19
Family Eukaryotic proteases 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015974   Gene: ENSSSCG00000015049   Transcript: ENSSSCT00000016415
Sequence length 79
Comment pep:known chromosome:Sscrofa10.2:9:46147984:46148697:-1 gene:ENSSSCG00000015049 transcript:ENSSSCT00000016415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDTVGAVCLPTEEQAFPRGSQCWVSGWGHTDPSHTHSSDTLQDTVVPLLSTQLCNSSCVY
SGALTPRMLCAGYLDGRAD
Download sequence
Identical sequences ENSSSCP00000015974 ENSSSCP00000015974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]