SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016009 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016009
Domain Number 1 Region: 190-431
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.12e-85
Family Eukaryotic proteases 0.0003
Further Details:      
 
Domain Number 2 Region: 99-197
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000249
Family Hepsin, N-terminal domain 0.047
Further Details:      
 
Domain Number 3 Region: 53-90
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000681
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016009   Gene: ENSSSCG00000015086   Transcript: ENSSSCT00000016452
Sequence length 435
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:50441613:50474695:1 gene:ENSSSCG00000015086 transcript:ENSSSCT00000016452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPASDQPLNSLDVAPQRKPRTPLQTFKKVGIPIIAALLGLAAIVVVAILIKVILDKYYF
LCWQPLHFIPREQLCDGQQDCASGEDEQLCVKKFPDGPPVAVRLSRDRSTLQVLHPATQT
WASACFDNFTEALAKTACGQMGYDSKPTFRAVRIGPDQDLDVVKITENDQELRVQNSSGP
CLSGSLVSLHCLACGESLKAPRVVGGEKASVDSWPWQVSIQYNKQHICGGSILDPHWILT
AAHCFWKHLDVPNWKVRAGSDKLGNFPSLPVAKIFITEPNSTSPKEKDIALVKLQLPLTF
SGTVRPICLPFSDEELTPGTPVWVIGWGFTEPNGGKMSDHLLQASVQVINRTRCNAEDAY
QGEVTEKMLCAGLLEGGVDTCQGDSGGPLMYHSGRWQAVGIVSWGYGCGGPSTPGVYTKV
TAYLDWIYNVRKVSL
Download sequence
Identical sequences ENSSSCP00000016009 9823.ENSSSCP00000016009 ENSSSCP00000016009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]