SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016043 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016043
Domain Number 1 Region: 56-388
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.32e-111
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000000000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016043   Gene: ENSSSCG00000015120   Transcript: ENSSSCT00000016486
Sequence length 396
Comment pep:known chromosome:Sscrofa10.2:9:51595405:51603732:-1 gene:ENSSSCG00000015120 transcript:ENSSSCT00000016486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTSYTVTLPEEPPAAPFPALAKELRPRSPLSPSLLLSTFVGLLLNKAKNSKSAQGLAGL
RNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLSHSSSAHTALMEEFAKLIQTIWTSS
PNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTVRPKSSPEGLDH
LPDDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRG
YPEVTLMDCMRLFTKEDVLDGDEKPTCCRCRARKRCIKKFSVQRFPKILVLHLKRFSESR
IRTSKLTTFVNFPLRDLDLREFASENINHAVYNLYAVSNHSGTTMGGHYTAYCRSPVTGE
WHTFNDSSVSPMSSSQVRTSDAYLLFYELASPPSRM
Download sequence
Identical sequences F1SAF6
ENSSSCP00000016043 9823.ENSSSCP00000016043 XP_003357373.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]