SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016054 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016054
Domain Number 1 Region: 392-505,625-762
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.25e-68
Family Phosphate binding protein-like 0.000000149
Further Details:      
 
Domain Number 2 Region: 18-233
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.68e-19
Family L-arabinose binding protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016054   Gene: ENSSSCG00000015131   Transcript: ENSSSCT00000016497
Sequence length 932
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:53071979:53308128:1 gene:ENSSSCG00000015131 transcript:ENSSSCT00000016497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPTAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSEYETAETMC
QILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFIKFQFQRFTTLNLHPSNT
DISVAVAGILNFFNCTTACLICAKAECLLNLEKLLRQFLISKDTLSVRMLDDTRDPTPLL
KEIRDDKTATIIIHANASMSHTILLKAAELGMVSAYYTYIFTNLLEFSNQKKQVVSFERP
GLFGWLVFGGFFFFCDVLSTLQSCWALWSQHTEFAGVIISKPVKTAASYWMMEEVKEMNR
SPFVGVRPLGCGGWESWEGGKGRENNLRVREALGVTARISVSSDGDQENLSSPALELSTE
GFCQIGQWHVADGLSMDSRLYASNISDSLFNTTLVVTTILENPYLMLKGNHQEMEGNDRY
EGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGTWTGMVGELIARKADLAVAGLTIT
AEREKVIDFSKPFMTLGISILYRVHMGRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFL
VARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFPVGGFMQQGSTIAPRALSTRCVSGV
WWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLADQTAIEYGTIHGGSSMTFFQNSRY
QTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAFLLESTMNEYYRQRNCNLTQIGGLL
DTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILKRKWWEGGKCPKEEDHRAKGLGMEN
IGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVSVCQEMVTELRSIILCQDSVHPRRR
RSGLPPPRPPIPEERRPRGTVTLSNGKLCGAGEPDQLAQRLAQEAALVARGCTHIRVCPE
CRRFQGLRARPSPARSEESLEWEKTTNSSEPE
Download sequence
Identical sequences ENSSSCP00000016054 ENSSSCP00000016054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]