SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016170 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016170
Domain Number 1 Region: 591-855
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.04e-90
Family Eukaryotic proteases 0.0000000215
Further Details:      
 
Domain Number 2 Region: 339-446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-29
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 3 Region: 214-332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-20
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 86-168
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000107
Family SEA domain 0.013
Further Details:      
 
Domain Number 5 Region: 488-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 6 Region: 525-559
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 453-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016170   Gene: ENSSSCG00000015246   Transcript: ENSSSCT00000016615
Sequence length 856
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:63159460:63176946:-1 gene:ENSSSCG00000015246 transcript:ENSSSCT00000016615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVLPQRGWEASEMGGIPEGQCFAFSVQNMNGFEEGVEFLPANNTQKVEKGGLRRWVVLVA
VLASILTLSLVAGLLVWHFQYRNVQVQKVFNGYLRVKNENFLDAYENSNSTEFANLANRV
KEALKVLYKGIPVLGPYHKKSAVTAFSEGSVIAYYWSEFSIPYYLVEEANRAMAEEHVVT
VPPRARSLGSIVLSSVVAFPTDPRTVQNTQDNSCNFALHAHGSELTRFTTPGFPDSPYPS
RAHCQWTLRGDANSALSLTFHSFDVSTCDERGSDLVMVYDTLSPVEPRAVVQLCGTYPPS
YNLTFLSSQNVLLVTLVTNTERRHPGFEAVFFQLPRMSSCGGYLRGTQGMFSSPYYPGHY
PPNINCTWNIEVPSNKNVKVRFKAFYLLEPNVPLGSCPKDYVEVNGERLCGEKPQFVVSS
RSNKITVHFHSDQSYTDTGFLAEYLSYDSSDPCPGKFMCNTGRCIEKELRCDGWADCTDY
SDEISCQCNATYQFMCKNKFCKPLFWVCDTVNDCGDGSDELGCSCPAETFKCDNGKCIPK
SQQCDGNDNCGDGSDEATCGSAGRTVACTKLTYRCLNGLCVSKVNPECDGQKDCSDGSDE
KDCDCGLRAFTRQSRVVGGENADEGEWPWQVSLHALGQGHVCGASLIAPSWMVSAAHCFV
DSRGFRYSDAKMWTAFLGLHDQSKRSVPGVQERRLQRITFHPFFNDFTFDYDIALLQLDQ
PVEYSPTVRPICLPDASHTFPTGKAIWVTGWGHTQEGGTGALILQKGEIRVINQTTCERL
LPQQITDRMMCVGYLSGGVDACQGDSGGPLSSVESDGRMFLAGVVSWGDGCAQRNKPGVY
TRLPVFRNWIKEQTGV
Download sequence
Identical sequences ENSSSCP00000016170 9823.ENSSSCP00000016170 ENSSSCP00000016170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]