SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016174 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016174
Domain Number 1 Region: 219-430
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.06e-54
Family Reprolysin-like 0.0018
Further Details:      
 
Domain Number 2 Region: 520-576
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000523
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 3 Region: 895-956
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000471
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 
Domain Number 4 Region: 843-897
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000536
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016174   Gene: ENSSSCG00000015250   Transcript: ENSSSCT00000016619
Sequence length 956
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:63398130:63422854:1 gene:ENSSSCG00000015250 transcript:ENSSSCT00000016619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPGAMLLLGILTLALAGAPAGGSEPEREVVVPIRLDPDINGRRYYRRGPEDSEDQGLIFQ
ITAFQEDFYLHLTPDAQFLAPAFATEHLGVPLQGLIESSPDLRRCFYSGDVNAEPDSFAA
VSLCGGIRGAFGYRGAEYVISPLPNASAPTAQRNSQGAHLLQRRAAPGGPPGDPTSRCGV
ASGWNPAILRALDAYKPPRIGLGEDRSRRRSGRAKRFVSIPRYVETLVVADESMVKFHGA
DLEHYLLTLLATAARLYRHPSILNPINIVVVKVLLLGDRDTGPKVTGNAALTLRNFCAWQ
KKLNKVSDKHPEYWDTAILFTRQDLCGATTCDTLGMADVGTMCDPKRSCSVIEDDGLPSA
FTTAHELGHVFNMPHDNVKVCEEVFGKLRANHMMSPTLIQIDRTHPWSACSAAIVTDFLD
SGHGDCLLDQPSKPISLPEDLPGASYTLSQQCELAFGVGSKPCPYMQYCTKLWCTGKAKG
QMVCQTRHFPWADGTSCGEGKFCLKGTCVERHNLNKYRVIVDGSWAKWEAYGPCSRTCGG
GVQLARRQCSNPAPANGGKYCEGVRVKYRSCNLESCPSSASGKSFREEQCEAFNGYNHST
NRLTLAVAWVPKYSGVSPRDKCKLICRANGTGYFYVLAPKVVDGTPCTPDSTSVCVQGKC
IKAGCDGNLGSKKKFDKCGVCGGDNRSCKKVSGLFTKPMHGYNFVVAIPAGASSIDIRQR
GYKGLIGDDNYLALKNSQGKYLLNGHFVVSAVERDLVVKGSLLRYSGTGTAVESLQASRP
ILEPLTVEVLSVGKMTPPRVRYSFYLPKEPREDRSSPPKEPRAPSVLHNSVLSLSNQVEQ
PDPQPPARWVAGSWGPCSVSCGGGLQRRQVDCRGSPGLRGVAACDAAHRPPETRPCGEPC
PAWELGAWSPCSKSCGRGFKRRPLKCVGHGGRLLARDRCNLRRKPQELDFCILRPC
Download sequence
Identical sequences ENSSSCP00000016174 ENSSSCP00000016174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]