SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016278 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016278
Domain Number 1 Region: 130-177
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000183
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 1206-1263
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000275
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 555-619
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000183
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 4 Region: 956-1013
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 285-338
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000811
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 6 Region: 696-749
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000249
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 7 Region: 1337-1392
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000889
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 8 Region: 622-691
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000235
Family TSP-1 type 1 repeat 0.0076
Further Details:      
 
Domain Number 9 Region: 1084-1139
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000981
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number 10 Region: 1258-1313
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000353
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 
Domain Number 11 Region: 1012-1083
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000353
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 12 Region: 827-882
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000667
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000016278
Domain Number - Region: 346-420
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000103
Family TSP-1 type 1 repeat 0.0069
Further Details:      
 
Domain Number - Region: 1141-1197
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000392
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number - Region: 433-498
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00301
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Domain Number - Region: 888-955
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0174
Family TSP-1 type 1 repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016278   Gene: ENSSSCG00000015350   Transcript: ENSSSCT00000016724
Sequence length 1580
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:88921415:89309423:-1 gene:ENSSSCG00000015350 transcript:ENSSSCT00000016724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPWGRCMGDECGPGGIQTRAVWCAHSEGWTTLHTNCKQAERPSNQQNCFKVCDWHKELYD
WRLGPWNQCQPVISKSLEKPLECIKGEEGIQVREITCIQKEKDVPAEDIICEYFEPKPLL
EACLIPCQQDCIVSEFSAWSECSKTCGSGLQHRTRQVVAPPQFGGSGCPNLTEFQVCQSS
PCEAAESLYSLQVGPWSTCSMPHSRQVRQARRRGKNKDPEARELIKKKRNRNRQNRQENK
YWDIQIGYQTREVMCTNKTGKTADLSFCKQEKLPMTFQACVIMKECQVSEWSEWSPCSKT
CHDMASPKGTRVRMRLIRQFPIGSEKECPELEEKEPCVSQGDGVAPCATYSWRTTEWTEC
RVDPLLSQQDKRRGNQTALCGGGIQTREVYCVQAKQNLPSQLNTPKDKEASKPVDVKSCT
GPVPNTTQLCHIPCPTECEVSPWTAWGPCTYENCNDQQGKKGFKLRKRRITNEPTGGSGG
TGNCPHLLEAIPCEEPSCYDWKAVRLGDCEPDNGKECGPGTQVQEVVCINSDGEEVDRQL
CRDAIFPIPVACDAPCPKDCVLSMWSAWSSCSHTCSGKTTEGKQIRARSILAYAGEEGGA
QCPNSSALQEVRSCNEHPCTVYHWQTGPWGQCIEDTSVSSFNTTTTWNGEASCSVGMQTR
KVICVRVNVGQVGPKKCPESLRPETVRPCLLPCRKDCIVTPYSDWTPCPSSCKEGDSGIR
KQTRHRVVIQLPANGGRDCTDPLYEEKACEAPQVCQSYRWKTHKWRRCQLVPWSVQQESP
GAQEGCGPGRQARAITCRKQDGGQASIHECLQNAGPVPALTQACQIPCQDDCQFTSWSKF
SSCNGDCGAVRTRKRTIVGKSKKKEKCKNSHLYPLIETQYCPCDKYNAQPVGNWSDCILP
EGKVEVLLGMKVQGDIKECGQGYRYQAMACYDQNGRLVETSRCNSHGYIEEACIIPCPSD
CKLSEWSNWSRCSKSCGSGVKVRSKWLREKPYNGGRPCPKLDHVNQVYEVVPCHSDCNQY
IWVTEPWSVCKVTFVNMRDNCGEGVQTRKVRCMQNTADGPSDHVEDYLCDPEEMPLGSRE
CKLPCPEDCVISEWGPWTRCTLPCNQNSFRQRSADPIRQPADEGRACPDAIEKEPCNLNK
NCFHYYYNVTDWSTCQLSEKAVCGNGIKTRMLDCVRSDGKSVNLKYCEELGLEKNWQMNT
SCMVECPVNCQLSDWSPWSECSQTCGLTGKMIRRRTVTQPFQGDGRPCPALMEQSKPCPV
KPCYQWQYGQWSPCKVQDAQCGEGTRTRNISCVVSDGSADDFSKVVDDEFCTDTEPIIDG
NKKMVLEESCTQPCPGDCYLKDWSSWSLCQLTCVNGEDLGFGGIQVRSRAVIIQELENQY
LCPEQMLETRPCDDGQCYEYKWMASAWKGSSRTVWCQRSDGVNVTGGCLVVRQPDADRSC
NPPCSQPHSYCSETRTCSCEEGYTEVMSSNGTLEQCTLIPVVVIPTVEDKREDVKTSRAV
HPTQPSSNPAGRGRTWFLQPFGPDGRLKTWVYGVAAGAFVLLIFIVSMIYLACKKPKKPQ
RRQNNRLKPLTLAYDGDADM
Download sequence
Identical sequences ENSSSCP00000016278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]