SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016293 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016293
Domain Number 1 Region: 290-382
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000768
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0054
Further Details:      
 
Domain Number 2 Region: 121-186
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000101
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.069
Further Details:      
 
Domain Number 3 Region: 37-79
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000301
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016293   Gene: ENSSSCG00000015364   Transcript: ENSSSCT00000016739
Sequence length 385
Comment pep:known chromosome:Sscrofa10.2:9:95356003:95391463:-1 gene:ENSSSCG00000015364 transcript:ENSSSCT00000016739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDDTFISSSLGFQKSSGYDINFLNKLLYSEEGEFLLQA
LNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPS
QCPDSGQRIDEASGLSQPAAYYNPEQLPPENSFMERCFVCRLRCLLDNSSGFLAMNFQGR
LKYLHGQNKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPTGCDA
KGKIVLGYTEAELCMRGTGYQFIHAADMLYCAEYHVRMIKTGESGMIVFRLLTKDNRWTW
VQSNARLVYKNGRPDYIIATQRPLT
Download sequence
Identical sequences ENSSSCP00000016293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]