SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016321 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016321
Domain Number 1 Region: 669-876
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.00000000000425
Family Mannose 6-phosphate receptor domain 0.0089
Further Details:      
 
Domain Number 2 Region: 601-675
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000126
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number 3 Region: 290-431
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000102
Family Growth factor receptor domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016321   Gene: ENSSSCG00000015394   Transcript: ENSSSCT00000016769
Sequence length 1029
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:103019596:103204485:1 gene:ENSSSCG00000015394 transcript:ENSSSCT00000016769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGQGPARGRGRGRRAGSPHCGLLQPWSPAWICCWALAGCQAAWAGDLPSSSSGRPLPP
CLEKDYHFEYTECDSSGSRWRVAIPNSAVDCSGLPDPVRGKECTFSCASGEYLEMKNQVC
SKCGEGTYSLGSGIKFDEWDELPAGFSNVATFMDTVVGPSDSRPDGCNNSSWVPRGNYIE
SNRDDCTVSLIYAVHLKKSGYVFFEYQYVDNNIFFEFFIQNDQCQEMDTTADKWVKLTDN
GEWGSHSVMLKSGTNILYWRTTGILMGSKAVKPVLVKNITIEGVAYTSECFPCKPGTFSD
KPGSFICQVCPRNTYSEKGAKECIKCDEDSQFSEEGSSECTERPPCTMKDYFQIHTPCDE
EGKTQIMYKWIEPKICREDLTDAIRLPPSGEKKDCPPCNPGFFNNGSSSCHPCPPGMFSD
GTKECRPCPAGTEPALGFEYKWWNVLPGNMKTSCFNVGNSKCDGMNGWEVAGDHIQSGAG
GSDNDYLILNLHIPGFKPPTSMTGAMGSELGRITFVFETLCSADCVLYFMVDINRKSTNV
VESWGGTKEKQAYTHVIFKNATFTFTWAFQRTNQGQDNRRFINDMVKIYSITATNAVDGV
ASSCRACALGSEQSGSSCVPCPPGHYIEKETNQCKECPPDTYLSIHQVYGKEACIPCGPG
SRSTQDHSVCYSDCFFYHEKENQSLRYDFSNLSSVGSLMNGPSFTSKGTKYFHFFNISLC
GHEGKKSALCTNNITDFTVKETAAGSEDYTNLVGAFVCQSTIIPSESKGFRAALSSQSII
LADTFLGVTVETTLQNINIKEDMFPVSPSQIPDVHFFYKSSTTTTSCVNGRSTAVKMRCN
PAKQGAGVISVPSKCPAGTCDGCSFYFLWESAEACPLCTEHDFHEIEGACKRGFQETLYV
WNEPKWCIKGISLPEKKLSTCETVDFWLKVGAGVGAFTAVLLVALTCYFWKKNQKLEYKY
SKLVMTTNSKECELPAADSCAIMEGEDNEEEVVYSNKQSLLGKLKSLATKEKEDHFESVQ
LKSSRSPNI
Download sequence
Identical sequences F1SBX6
XP_003130265.3.46622 ENSSSCP00000016321 ENSSSCP00000016321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]