SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016330 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016330
Domain Number 1 Region: 492-719
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.11e-58
Family Eukaryotic proteases 0.00000000522
Further Details:      
 
Domain Number 2 Region: 112-208
Classification Level Classification E-value
Superfamily Kringle-like 8.22e-36
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 3 Region: 207-291
Classification Level Classification E-value
Superfamily Kringle-like 1.55e-33
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 4 Region: 299-382
Classification Level Classification E-value
Superfamily Kringle-like 7.97e-32
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 5 Region: 378-474
Classification Level Classification E-value
Superfamily Kringle-like 1.01e-28
Family Kringle modules 0.0004
Further Details:      
 
Domain Number 6 Region: 33-122
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 9.42e-22
Family Hairpin loop containing domain 0.00000518
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016330   Gene: ENSSSCG00000015403   Transcript: ENSSSCT00000016778
Sequence length 727
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:108773026:108839094:1 gene:ENSSSCG00000015403 transcript:ENSSSCT00000016778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESIIPLIIPLPTTRHLVFCQKLLLLIEGQKKRRNTLHEFKKSAKTTLINEDPLLKIKTKK
MNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVKKEFGHEFDLYENKD
YIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNPRGE
EGGPWCFTSNPEVRYEVCDIPQCSEVECLTCNGESYRGPMDHTESGKICQRWDHQTPHRH
KFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSTMNDTDVPMETT
ECIQGQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGAESP
WCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMEDLH
RHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHP
VISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSRNKDL
KDYEAWLGIHDVHGRGDEKRKQVLNVTQLVYGPEGSDLVLLKLARPAVLDDFVSTIDLPN
YGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQYHQGKVTLNESEICAGA
ENIVSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIIL
TYKVSQS
Download sequence
Identical sequences ENSSSCP00000016330 ENSSSCP00000016330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]