SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016389 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016389
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000196
Family Laminin G-like module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016389   Gene: ENSSSCG00000015457   Transcript: ENSSSCT00000016839
Sequence length 126
Comment pep:novel scaffold:Sscrofa10.2:JH118953.1:13162:20786:-1 gene:ENSSSCG00000015457 transcript:ENSSSCT00000016839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGAFFEEGMWLRYNFQAPGVNAKESGSFSTTKAPCILLYVSSLTTDFLAVLVKPTGSLQI
RYNLGGTREPYNIDVEHRNMANGQPHSVNITRHEKTIILKVSICYLSIVHDIVMQSLSSV
ILGRVL
Download sequence
Identical sequences ENSSSCP00000016389 ENSSSCP00000016389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]