SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016392 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016392
Domain Number 1 Region: 5-116
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.85e-19
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 2 Region: 90-188
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000001
Family Laminin G-like module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016392   Gene: ENSSSCG00000015461   Transcript: ENSSSCT00000016843
Sequence length 197
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:121943609:121952731:-1 gene:ENSSSCG00000015461 transcript:ENSSSCT00000016843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNQLGPIYGHTSVTTGSLLDDHHWHSVVIERQGRSINLTLDRSMQHFRTNGEFDYLDLDY
EITFGGIPFSGKPSSSSRKNFKGCMESINYNGINITDLARRKKLEPSNVGNLSFSCVEPY
TVPVFFNATSYLEVPGRLNQDLFSVSFQFRTWNPNGLLLFSHFADNLGNVEIDLTESKVG
VHINITQTKMSQIDISS
Download sequence
Identical sequences 9823.ENSSSCP00000016392 ENSSSCP00000016392 ENSSSCP00000016392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]