SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016450 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000016450
Domain Number - Region: 343-404
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000132
Family Growth factor receptor domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016450   Gene: ENSSSCG00000015515   Transcript: ENSSSCT00000016902
Sequence length 694
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:130733849:130820053:1 gene:ENSSSCG00000015515 transcript:ENSSSCT00000016902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REFARWKVNNLALERKDFFSLPLPLAPEFIRNIRLLGRRPNLQQVTENLIKKYGTHFLLS
ATLGGEESLTIFVDKRKLSRKSETAGSAPIVGGSGNSSAVSLETLHQLAASYFIDRESTL
RRLHHIQIATGAIKVTETRTGPLGCSNYDNLDSVSSVLVQSPENKVQLLGLQVLLPEYLR
ERFVAAALSYITCSSEGELICKENDCWCKCSPTFPECNCPDADIQAMEDSLLQIQDAWAT
HNRQFEESEEFQALLKRLPDDRFLNSTAISQFWAMDTSLQHRYQQLGASLKVLFKKTHRI
VRRLFNLCKRCHRQPRFRLPKERSLSYWWNRIQSLLYCGESTFPGTFLEQSHSCTCPYDQ
SSCQGPIPCALGEGPACAHCAPDNSTRCGSCNPGYVLAQGLCRPEVAESLENFLGLETDL
QDLELKYLLQKRDSRIEVHSIFISNDMRLGSWFDPSWRKRMLLTLKSNKYKPGLVHVMLA
LSLQICLTKNSTLEPVMAIYVNPFGGSHSESWFMPVNEGDFPDWERTNVDAAAQCQNWTI
TLGNRWKTFFETVHVYLRSRIKSLDDSSNETIYYEPLEMTDPSKNLGYMKINTLQVFGYS
LPFDPDAIRDLILQLDYPYTQGSQDSALLQLIELRDRVNQLSPPGKVRLDLFSCLLRHRL
KLATNEVGRIQSSLRAFNSKLPNPVEYETGKLCS
Download sequence
Identical sequences ENSSSCP00000016450 ENSSSCP00000016450 9823.ENSSSCP00000016450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]