SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016481 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016481
Domain Number 1 Region: 110-362
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 7.75e-80
Family Glutamine synthetase catalytic domain 0.0018
Further Details:      
 
Domain Number 2 Region: 20-109
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.96e-20
Family Glutamine synthetase, N-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016481   Gene: ENSSSCG00000015545   Transcript: ENSSSCT00000016935
Sequence length 373
Comment pep:known chromosome:Sscrofa10.2:9:135908577:135968462:-1 gene:ENSSSCG00000015545 transcript:ENSSSCT00000016935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCIEELPEW
NFDGSSTFQSEGSNSDMYLVPAAMFRDPFRKDPNKLVFCEVFKYNRKPAETNLRHTCKRI
MDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY
RACLYAGIKIGGTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDP
KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL
TGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPFAVTEALIRTCL
LNETGDEPFQYKN
Download sequence
Identical sequences D0G6X5
ENSSSCP00000016481 ENSSSCP00000016481 9823.ENSSSCP00000016481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]