SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016565 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016565
Domain Number 1 Region: 216-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000607
Family VWC domain 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000016565
Domain Number - Region: 153-213
Classification Level Classification E-value
Superfamily FnI-like domain 0.000408
Family Fibronectin type I module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016565   Gene: ENSSSCG00000015626   Transcript: ENSSSCT00000017020
Sequence length 325
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:149509307:149609191:1 gene:ENSSSCG00000015626 transcript:ENSSSCT00000017020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSTAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQEKREHASRDGPGRVS
ELGRPARDEGGGGRDWKGKGGRGLTSREAWSRQKQAWPAQGGGAKAGDLQVRPRGDTPHE
EPPAASAQDAAGSDPGPTLEPPEEYAYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLC
TEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCR
CEASGEVLCAVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTIC
HCTYEEGTWRIERQAMCTRHECRQM
Download sequence
Identical sequences F1SF29
ENSSSCP00000016565 ENSSSCP00000016565 XP_020919566.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]