SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016602 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016602
Domain Number 1 Region: 152-273
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.12e-16
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.037
Further Details:      
 
Domain Number 2 Region: 38-129
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000113
Family Ubiquitin-related 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016602   Gene: ENSSSCG00000015659   Transcript: ENSSSCT00000017057
Sequence length 348
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:74057171:74059563:-1 gene:ENSSSCG00000015659 transcript:ENSSSCT00000017057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGPAKGGHFGVPREAGFPGGVSQRAAGTKAGSTGVWPMGGQSDTMWRLRCKAKDGTHVL
QGLSSRTRVRELQGQIAAITGIAPDCQRILVGYPPECLDLSEGDTILGDLPIQSGDMLIV
EEDQTRPKTSPAFTKHGAPSYVREPLPVLTRTTVPADNSCLFTSVYYVVEGGVLNPACAP
EMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVD
TQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRVFPDPDTPPLTIFSSNDDIVLVQALEL
ADEARSKRQFTDVNRFTLRCMVCQKGLTGQAEARDHAKETGHTNFGEV
Download sequence
Identical sequences A0A287AKB2
ENSSSCP00000016602 XP_013835092.1.46622 XP_020918990.1.46622 XP_020918992.1.46622 ENSSSCP00000016602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]