SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016666 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016666
Domain Number 1 Region: 26-212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-38
Family Laminin G-like module 0.0068
Further Details:      
 
Domain Number 2 Region: 211-396
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.08e-36
Family Laminin G-like module 0.0055
Further Details:      
 
Domain Number 3 Region: 846-1050
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-29
Family Laminin G-like module 0.0068
Further Details:      
 
Domain Number 4 Region: 666-841
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.99e-18
Family Laminin G-like module 0.026
Further Details:      
 
Domain Number 5 Region: 453-513
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000602
Family Fibrinogen C-terminal domain-like 0.0047
Further Details:      
 
Domain Number 6 Region: 425-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000104
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016666   Gene: ENSSSCG00000015726   Transcript: ENSSSCT00000017126
Sequence length 1184
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:31248003:31803163:-1 gene:ENSSSCG00000015726 transcript:ENSSSCT00000017126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLQTFAGNMNADSVMHHKLLHSVRARFIRFVPLEWNPSGKIGMRVEVYGCSYKSDVADFD
GRSSLLYRFNQKLMSTLKDVISLKFKSMQGDGVLFHGEGQRGDQITLELQKGRLALHLNL
DDSKPRLSSSPPSATLGSLLDDQHWHSVLLERVGKQVNFTVDKHTQHFRTKGEADALDID
YELSFGGIPVPGKPGTFLKKNFHGCMENLYYNGVNIIDLAKRRKHQIYTVGNVTFSCSEP
QIVPITFVNSSSSYLLLPGTPQLDGLSVSFQFRTWNQDGLLLSTMLSEGSGTLLLSLEGG
RLRLVIQKMTERAAEILTGRNLNDGLWHLLSINARRNRITLTLDNDAASPAQDTSRMQIY
SGNSYYFGGCPDNLTDSQCLNPTKAFQGCMRLIFIDNQPKDLISVQQGSLGNFSDLHIDL
CSIKDRCLPNYCEHGGSCSQSWTTFYCNCTDTGYVGATCHNSLYEQSCEVYRHQGNTAGF
FYIDSDGSGPLAPFQVYCNITEDKIWTSVQHNHMELTHVRGASAEKPYSMVLDYKGSLEQ
LTAVIDGSEHCEQEVAYHCKRSRLLNTPDGAPLTWWMGRSNERHPYWGGAPPGVQQCDCG
LDESCLDIRHFCNCDADQEEWTNDTGFLSFKDHLPVTQIVITDTNRSNSEAAWRIGPLRC
YGDRHFWNAVSFYTEASYLHFPTFHAEFSADISFFFKTTALSGVFLENLGIKDFIRLEIS
XKKKIFXLVDVFQGPPLYLVGSPLSLMFKDTNWGTVRRENNLKITYVQQTNLGSSWRTGS
QKTHILFPTNCNMDLGGTSSRQKGFLGCIRSLHLNGQKLDLEERAKVTSGVRPGCPGHCS
SYGSTCHNGGKCVEKHSGYFCDCTTSPYEGPFCKKEVSAVFEAGTSVTYVFQEPYPVTKN
LSLSSSAIYVDAAPSRENIALSFVTAQVPGLLLYVNSSSQDSLAVLICKNGSLQVRYQLS
KEEIHVFTIDTENFANRRLHHLKINREGRGLTIQVDEQLRLSYNFSPEAEFRAGKSLTLG
KVTETLGLDAEVAKANILGFIGCLASVQYNHIAPLKAALRHATIAPVTIQGTLTESSCSS
VMDSDVNAVTTVHSSSDLFGKTDEREPLTNAVRSDSAVIGGVIAVVIFIIISVIGIMTRF
LYQHRQSHRTNQMEKEYPENLDTSFRNDIDLQSTVSECKREYFI
Download sequence
Identical sequences ENSSSCP00000016666 ENSSSCP00000016666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]