SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016711 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016711
Domain Number 1 Region: 156-251
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.96e-22
Family Middle domain of MutM-like DNA repair proteins 0.014
Further Details:      
 
Domain Number 2 Region: 64-148
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.0000000955
Family N-terminal domain of MutM-like DNA repair proteins 0.009
Further Details:      
 
Domain Number 3 Region: 319-346
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000053
Family Ran binding protein zinc finger-like 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000016711
Domain Number - Region: 246-283
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0394
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016711   Gene: ENSSSCG00000015771   Transcript: ENSSSCT00000017172
Sequence length 596
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:45495291:45542560:1 gene:ENSSSCG00000015771 transcript:ENSSSCT00000017172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEGPGCTLNGEKIRARVRPGQAVTDVRGSALQNAGGPGLPLSASETVVPSQAIALNNNK
LCSQNSLRLLNGHVYSGVETLGKELFMYFGPKALRIHFGMKGSLAINPLESKSKNGVSPV
FEVQLTKDLICFFDSSVEIRNTAESQQRIRMMEELDVCSPKFSFSRAEREVKKQGGRMLC
DVLMDQKVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQTHHLVKMIHDFSILFYRCCKA
GSAVSKHYKVYKRPNCGQCFCKITVCRLGENNRMTYFCPHCQKENPQHVDICLLPARNTF
VPWPSSRENHFTDCVARKSEEQWTCEVCTLINKPSSQACDACLSSRPVDSVLENKENPTA
LNNLVKYPCNSFGKPRTEVKINRKTAFGTTTLVLTDFSNKSSALKREESQKQILDGEFPN
PLSSPERANYITQLSNKVNVLPMICTQSKIFSPAYTNLKTTHYSSPDHKTCNPGFSNSEL
QINTTDGPHTLNAGSPRCSKHGRPCILRVVRKDGENKGRQFYACPLPREAQCGFFEWADL
SFPFCNHGKRSIMRTVLKIGPNNGKNFFVCPLGKEKQCNFFQWAENGPGINIIPGC
Download sequence
Identical sequences F1RT18
ENSSSCP00000016711 9823.ENSSSCP00000016711 ENSSSCP00000016711 XP_001926185.2.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]