SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016735 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000016735
Domain Number - Region: 293-431
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000358
Family Autophagin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016735   Gene: ENSSSCG00000015793   Transcript: ENSSSCT00000017196
Sequence length 470
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:53234677:53252191:-1 gene:ENSSSCG00000015793 transcript:ENSSSCT00000017196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVISETMDILFRIRGGLDLAFQLATPNEIFVKKALKHVLSDLSTKLSSNALVFRICHSSV
YIWPNSDMNTIPGELTDSSACKNIMRFIQFEQEEDTKRKFMRKREKKLSDMHQIVNIDLM
LEMSTPLAAVTPIIERESGGHHYVNMTLPVDAVISVAPEETWGKVRKLLVDAIHNQLTDM
EKCILKYIKGTSIVVPEPLHFLLPGGKNLVTISYPSGIPDGQLQDYRKELHDLFNLPHDR
PCFKRSNAYHFPDEPYKDGYIRNPHTYLNPPNIETGMIYVVQGTYGYHHYMQDRVDDNGW
GCAYRSLQTICSWFKHQGYTERPIPTHREIQQALVDAGDKPATFVGSRQWIGSIEVQLVL
NHLIGITSKILFVSQGSEMASQGRELANHFQTEGTPVMIGGGVLAHTILGVAWNEITGQI
KFLILDPHYTGAEDLQVILEKANFLKAKNPEPKDRKQAANRKMDYKPRVV
Download sequence
Identical sequences ENSSSCP00000016735 ENSSSCP00000016735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]