SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016742 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016742
Domain Number 1 Region: 391-635
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.08e-94
Family Eukaryotic proteases 0.000000549
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000016742
Domain Number - Region: 135-162
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00053
Family Pan module (APPLE domain) 0.054
Further Details:      
 
Domain Number - Region: 306-348
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00128
Family Pan module (APPLE domain) 0.029
Further Details:      
 
Domain Number - Region: 230-286
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0133
Family Pan module (APPLE domain) 0.03
Further Details:      
 
Domain Number - Region: 49-71
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0216
Family Pan module (APPLE domain) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016742   Gene: ENSSSCG00000015799   Transcript: ENSSSCT00000017203
Sequence length 643
Comment pep:known chromosome:Sscrofa10.2:15:53912808:53941519:1 gene:ENSSSCG00000015799 transcript:ENSSSCT00000017203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVIVLFRIISFRQAVYFMCLFAAVSCGCLPQLHKNTFFRGGDVSAMYTPSARHCQMMCT
FHPRCLLFSFLPADSTSVTDKRFGCFLKDSVTGMLPRVLRKNAISGHSLKQCGHQIRACH
RDIYKGIDMRGVNFNVSKVKSVEECQKRCTNSIHCLFFTYATQAFNNAEYRNNCLLKHSP
GGTPTSIKVLANVESGFSLKPCADSEIGCHMDIFQHLAFSDVDVARVIAPDAFVCRTICT
YHPNCLFFTFYTNAWKIESQRNVCFLKTSHSGTPSSPTPQENAISGYSLLTCKQTLPEPC
HSKIYSEVDFEGEELNVTFVQGANLCQETCTKTIRCQFFTYSLHPEDCRGEKCKCSLRLS
SDGSPTKITHGMRASSGYSLRLCRSGDHSACATKANTRIVGGTDSFLGEWPWQVSLQAKL
RAQNHLCGGSIIGHQWVLTAAHCFDGLSLPDIWRIYGGILNISEITKETPFSQVKEIIIH
QNYKILESGHDIALLKLETPLNYTDFQKPICLPSRDDTNVVYTNCWVTGWGFTEEKGEIQ
NILQKVNIPLVSNEECQKSYRDHKISKQMICAGYKEGGKDACKGDSGGPLVCKYNGIWHL
VGITSWGEGCARREQPGVYTKVIEYMDWILEKTQDDDGQSWMK
Download sequence
Identical sequences ENSSSCP00000016742 ENSSSCP00000016742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]