SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016757 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016757
Domain Number 1 Region: 175-337
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.37e-45
Family Prokaryotic proteases 0.00000522
Further Details:      
 
Domain Number 2 Region: 39-125
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000706
Family Growth factor receptor domain 0.003
Further Details:      
 
Domain Number 3 Region: 110-157
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000437
Family Ovomucoid domain III-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016757   Gene: ENSSSCG00000015810   Transcript: ENSSSCT00000017218
Sequence length 339
Comment pep:novel chromosome:Sscrofa10.2:15:54842665:54848021:1 gene:ENSSSCG00000015810 transcript:ENSSSCT00000017218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRTLLRPAGLRQLLLLWLLLPHAPGAGVEARTVRPAPPCPAVCEPMRCPPLPSCSAGTA
PVLDRCGCCRVCAAAEGEACGAALRRPCAPGLQCLAPPSPRLLGSSGLGTCRCPAAGAAV
CGSDGRTYPNLCALRARNHAARLRGGLPAVHVHEVDCGDPGTRSAGWLRSKYNFIAEVVE
KVAPSVVHLQLFSRSPLSNKDVPASSASGFIVSEDGLIVTNAHVLTNRHRIQVELQNGVQ
YEATVKDIDHKLDLALIKIEPKTDLPVLLLGKSSDLRAGEFVVALGSPFSLQNTVTAGIV
STTQRGGKELGLKDSDMDYIQTDAIINHGNSGGPLVNLV
Download sequence
Identical sequences ENSSSCP00000016757 ENSSSCP00000016757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]